DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serping1

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_033906.2 Gene:Serping1 / 12258 MGIID:894696 Length:504 Species:Mus musculus


Alignment Length:385 Identity:100/385 - (25%)
Similarity:171/385 - (44%) Gaps:67/385 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLL-AKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKEVAAKFKDL 80
            |:..||... |.:.|..|:..||.|:...|:...:||...|...:..:|..|.|       |..:
Mouse   154 FSVKLYHAFSATKMAKTNMAFSPFSIASLLTQVLLGAGDSTKSNLESILSYPKD-------FACV 211

  Fly    81 LSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKI-------TASIV 138
            ...|:|..|..:.|::         ::....:..::|::...::::..::|::       ...::
Mouse   212 HQALKGFSSKGVTSVS---------QIFHSPDLAIRDTYVNASQSLYGSSPRVLGPDSAANLELI 267

  Fly   139 NKWVDTQTSGKIRDLV--MPSDVANLVLVILNAIYFKGQWQKKFNTEQTKSDFHISDQKSVPVQM 201
            |.||...|:.|||.|:  :|||..   ||:|||:|...:|:..|..::..:.|...: ..:.|.|
Mouse   268 NTWVAENTNHKIRKLLDSLPSDTC---LVLLNAVYLSAKWKITFEPKKMMAPFFYKN-SMIKVPM 328

  Fly   202 MSLVR-PFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFTPKLININV--- 262
            ||.|: |.....|..|.|.|.:|.. :.|||.||.:|    ..|:.:.|.|   .|.:|..|   
Mouse   329 MSSVKYPVAQFDDHTLKAKVGQLQL-SHNLSFVIVVP----VFPKHQLKDV---EKALNPTVFKA 385

  Fly   263 -------------HLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFN--DLVANSGAHVGGVVH 312
                         :|.:|..|::.|   :.:|..|...:.|..:.|.|  .|..:....|..:.|
Mouse   386 IMKKLELSKFLPTYLTMPHIKVKSS---QDMLSVMEKLEFFDFTYDLNLCGLTEDPDLQVSAMKH 447

  Fly   313 KAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAENIY--FQGHFVNP 370
            :..||:.|.|.|||||:|:.|.    ||.|: |.|..||.:::.|.::.:  |.|...:|
Mouse   448 ETVLELTESGVEAAAASAISFG----RSLPI-FEVQRPFLFLLWDQQHRFPVFMGRVYDP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 99/383 (26%)
Serping1NP_033906.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..141
serpinG1_C1-INH 141..500 CDD:381006 99/381 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.