DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPINA3

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:375 Identity:122/375 - (32%)
Similarity:189/375 - (50%) Gaps:19/375 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL---PDDKKEV 73
            |.:..|...||:.|..:..|||:|.||||:..||:...:||...|..|:...||.   ...:.|:
Human    51 SANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEI 115

  Fly    74 AAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITASIV 138
            ...|:.||..|........||:.|.::|..:..|:..:.:..|..:.:||.|....:......::
Human   116 HQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI 180

  Fly   139 NKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQT-KSDFHISDQKSVPVQMM 202
            |.:|...|.|||.||:...| :..::|::|.|:||.:|:..|:.:.| :|.|::|.:|.|.|.||
Human   181 NDYVKNGTRGKITDLIKDLD-SQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMM 244

  Fly   203 SLVRPFGVSY--DRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFTPKLININVHLR 265
            || ....:.|  |.||...|:||.| ..|.|.:..|||: |.:.|:|..::..|.|....::..|
Human   245 SL-HHLTIPYFRDEELSCTVVELKY-TGNASALFILPDQ-DKMEEVEAMLLPETLKRWRDSLEFR 306

  Fly   266 ------LPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSE 324
                  ||||.|.....|..:|:.:||::||.:.||.:.:.......|..|||||.|:|.|||:|
Human   307 EIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVFEEGTE 371

  Fly   325 AAAATAV-VFRYKSIRSPPMDFNVNHPFAYVI--RDAENIYFQGHFVNPE 371
            |:||||| :....::.........|.||..:|  .|.:||:|.....||:
Human   372 ASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPK 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 119/370 (32%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 121/373 (32%)
RCL 369..394 8/24 (33%)
O-glycosylated at one site 381..389 0/7 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.