DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb7

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_569088.1 Gene:Serpinb7 / 117092 RGDID:71063 Length:380 Species:Rattus norvegicus


Alignment Length:379 Identity:110/379 - (29%)
Similarity:192/379 - (50%) Gaps:34/379 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKE---- 72
            :.:..|..||::.:.....:.|:..|.||:..||||..:||||..|:::...|......::    
  Rat     6 AANAEFGFDLFREMDSSQGNGNVFFSSLSIFTALSLIRLGARGDCARQIDKALHFISPSRQGNSS 70

  Fly    73 -----VAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAIS-ANNP 131
                 :..:.|.:|:.:........||:||.::....|.....|.:..::.:.|:.|.:. .|:.
  Rat    71 NSQLGLQYQLKRVLADINSSHKDYELSIANGVFAEKVFDFHKSYMECAENLYNAKVERVDFTNDI 135

  Fly   132 KITASIVNKWVDTQTSGKIRDLVMPSDV-ANLVLVILNAIYFKGQWQKKFNTEQTKSD-----FH 190
            :.|...:|||::.:|.|||:.::..|.: ::.|:|::||:||||:|:..|    ||||     |.
  Rat   136 QETRFKINKWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAF----TKSDTLSCHFR 196

  Fly   191 ISDQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGF-- 253
            ........|.||...|.|.:|..:|....::||.| :..:||.|.||:  |.|.|:|.|: .|  
  Rat   197 SPSGPGKAVNMMHQERRFNLSTIQEPPMQILELQY-HGGISMYIMLPE--DDLSEIESKL-SFQN 257

  Fly   254 ------TPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVV 311
                  :.|:.:..|::.||:||||....:...|.::|::|.| ::.||.:.:.:....:|..::
  Rat   258 LMDWTNSRKMKSQYVNVFLPQFKIEKDYEMRSHLKSVGLEDIFVESRADLSGIASGGRLYVSKLM 322

  Fly   312 HKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAENIYFQG 365
            ||:.:||:|||:||.|||......|.:....: |..:.||.:|||....|.|.|
  Rat   323 HKSLIEVSEEGTEATAATESNIVEKLLPESTV-FRADRPFLFVIRKNGIILFTG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 110/377 (29%)
Serpinb7NP_569088.1 SERPIN 4..380 CDD:294093 110/379 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46144
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.