DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinb6c

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001369781.1 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:364 Identity:113/364 - (31%)
Similarity:188/364 - (51%) Gaps:17/364 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGL---ASSDPEQIAH 107
            |.|::|:. |:.|:...:|:..||.||.:...|..|||:..||.|:.|.|.|   :||:...:..
Mouse    10 ATFALNLL-KILGEDRSKNVFLSPISISSALVMVLLGAKGTTAIQITQALSLGKCSSSEDGDVHQ 73

  Fly   108 SFHQVLAAYQDS---QILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDF-SKNVQAAATIN 168
            .|..:|:....:   ..|:.||::|....:.:...|.....|.:.:..:.:|| ....|:...||
Mouse    74 GFQLLLSEVNKTGTQYSLKAANRLFGEKTFDILASFKDSCHKFYEAEMEELDFKGATEQSRQHIN 138

  Fly   169 NWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMM 233
            .||.::|...||:|:....::|.:.|:||||::|||.|:.||.|..||...|.:.......|.||
Mouse   139 TWVAKKTEDKIKELLSPGTIHSNTPLILVNAVYFKGKWEKQFNKEDTREMPFKVSKNEEKPVQMM 203

  Fly   234 SLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQ--SLYET 296
            ..|..|:...:..:....|.|||..::|:|:|:||:....|..:|:::......:.|:  .:...
Mouse   204 FQKSTFKMTYVEEISTKILLLPYVGNELNMIIMLPDEHVELSTVEKEITHEKFIEWTRLDRMKGE 268

  Fly   297 KVALKLPRFKAEFQVELSEVFQKLGMSRMFSD-QAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGT 360
            ||.:.||.||.|...::.:|..||||:..|.: :|:|.. :.|.:.|.:|.:|||:.:||||||:
Mouse   269 KVEVFLPWFKLEENYDMKDVLCKLGMTDAFEEGRADFSG-ISSKQGLFLSNVIHKSVVEVNEEGS 332

  Fly   361 EAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQK 399
            ||.|||.:.::..    |...|. |..:.||.:.:.|.|
Mouse   333 EATAATTIVLKGS----SRSTPC-FCVNRPFIFFIQHIK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 113/364 (31%)
Serpinb6cNP_001369781.1 serpin 2..379 CDD:422956 113/364 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.