DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINH1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:393 Identity:94/393 - (23%)
Similarity:169/393 - (43%) Gaps:26/393 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TADVTMADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLD 92
            ||:.....||  ..|.|.|..:.::|..::..:..|||:.||..:.:...:..||.:..||:|..
Human    32 TAEKLSPKAA--TLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAK 94

  Fly    93 QGLGLASSDPEQIAHSFHQVLAAYQDSQ----ILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQ 153
            ..|.......|::.....::|.:..:|.    ..::.::::.........:|.: .|||..:...
Human    95 AVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVR-SSKQHYNCEH 158

  Fly   154 S-VDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRP 217
            | ::|.....|..:||.|..|.|:..:.: |..||..::..| ||||:.||..|..:|...:...
Human   159 SKINFRDKRSALQSINEWAAQTTDGKLPE-VTKDVERTDGAL-LVNAMFFKPHWDEKFHHKMVDN 221

  Fly   218 DTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLR 282
            ..|.:....||.|.||.....:.|.|........:|:|......|::|::|:....|..||:.|.
Human   222 RGFMVTRSYTVGVMMMHRTGLYNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLT 286

  Fly   283 LTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMF-SDQAEFGKMLQSPEPLKVSA 346
            ...|......:.:..||:.||:...|...:|.:....||::... .::|:..:| ...:.|.:::
Human   287 KEQLKIWMGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRM-SGKKDLYLAS 350

  Fly   347 IIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEE---PIEFFADHPFTYVLVH-QKDLPLFWGS 407
            :.|....|::.:|...          .:.|...||   |..|:|||||.:::.. |....||.|.
Human   351 VFHATAFELDTDGNPF----------DQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGR 405

  Fly   408 VVR 410
            :||
Human   406 LVR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 86/372 (23%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 92/389 (24%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.