DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINA6

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:401 Identity:119/401 - (29%)
Similarity:194/401 - (48%) Gaps:16/401 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDYRLVPCGCWLLPLLGLALFPFPPVHTADVTMADAAHQEFARRLALFSINVYGKLSGQKPGENI 65
            |...|..|..| ||..||........:.|.|.|:: .|:..|.....|:.::|..|....|.:||
Human     1 MPLLLYTCLLW-LPTSGLWTVQAMDPNAAYVNMSN-HHRGLASANVDFAFSLYKHLVALSPKKNI 63

  Fly    66 VFSPFSIQTCAAMARLGAENETATQLDQGLG--LASSDPEQIAHSF---HQVLAAYQDSQILRIA 125
            ..||.||....||..||....|..||.||||  |......:|...|   ||:.|....|..:.:.
Human    64 FISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMG 128

  Fly   126 NKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNS 190
            |.:|:....:|.:.|...:...:.|...:::|.....|:..||::|:.:|...|.||...  |:|
Human   129 NALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSG--LDS 191

  Fly   191 ESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELP 255
            .:.|||||.|.|||||...|....||.:.|::|....|:||||.......|.....|....:::.
Human   192 PAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMN 256

  Fly   256 YKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKL 320
            |..:. ::..:||: |..:..:...|...|:::.:..|..::|.|.:|:.......:|.:|.:::
Human   257 YVGNG-TVFFILPD-KGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEM 319

  Fly   321 GMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVR--RKRAIMSPEEP- 382
            |::.:|::||.|.::.|..: ||.|.::|||.:::||||.:.|.:||:.:.  .|..|:...:| 
Human   320 GIADLFTNQANFSRITQDAQ-LKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPF 383

  Fly   383 IEFFADHPFTY 393
            |....|| ||:
Human   384 IIMIFDH-FTW 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 106/357 (30%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 106/358 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.