DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpina3a

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001161177.1 Gene:Serpina3a / 74069 MGIID:1921319 Length:422 Species:Mus musculus


Alignment Length:421 Identity:119/421 - (28%)
Similarity:200/421 - (47%) Gaps:52/421 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGLALFPFPPV----HTADVTMA-------DAAHQEFARRLALFSIN------VYGKLSGQKPGE 63
            |||.:....|.    .|||..:.       |..|:.....:.|.|||      :|.||:.:.|.:
Mouse     7 LGLLMAGICPAITYWATADGQLGRHTEVQKDRDHEIQLDSVTLASINTDFAFSLYKKLALKNPHK 71

  Fly    64 NIVFSPFSIQTCAAMARLGAENETATQLDQGL--GLASSDPEQIAHSF-H--QVLAAYQDSQILR 123
            ||||||.||....|:..|||::.|..::.:||  .|..:....|..:| |  |:|...::...:.
Mouse    72 NIVFSPLSISAALALMSLGAKDNTLEEILEGLKFNLTETPEADIHQNFGHLLQMLIQPENQVQIN 136

  Fly   124 IANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVL 188
            ..|.:|:....|:..||.:.....:.:.|.:.||....:|...||::|.::|...||:|| :| |
Mouse   137 AGNALFIDKHLQILTEFKEKARALYKAEAFTADFQLPREATKLINDYVRKQTQGKIKELV-SD-L 199

  Fly   189 NSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKE----RFRYADLPALDA 249
            :..:.:.|||.::|:|.|...|....|....|.||.:|||.||||..:|    .||..:   :.:
Mouse   200 HRNTSMALVNFLNFQGFWNVTFDPEDTFLGNFTLDRKRTVNVPMMKTEELTTNYFRDEE---MQS 261

  Fly   250 MALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKV-ALKLPRFKAEFQVEL 313
            ..:||.| ..:.|.|.:||: :..:..:|:.|:..:|.:..:||....: .|.||:|.......|
Mouse   262 TVMELNY-IGNASFLFILPD-QGRIQHVEDSLQPQSLRKWRKSLRPRMLDELSLPKFSLSQDYNL 324

  Fly   314 SEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAAT-----GMAVRRK 373
            :::..:||:..:||.||:... :...:.::||.:||:|.::|.|..|||...|     ..:.:.|
Mouse   325 NDILPELGIKEVFSTQADLSG-ITGAKNIRVSQMIHQAALDVTETHTEADVITIARYNFQSAKIK 388

  Fly   374 RAIMSPEEPIEFFADHPFTYVLVHQKDLPLF 404
            ..|:.        .|..|.|:::.    |:|
Mouse   389 AKIVK--------VDREFLYLILD----PMF 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 110/381 (29%)
Serpina3aNP_001161177.1 SERPIN 53..416 CDD:294093 107/375 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.