DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINA7

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:403 Identity:116/403 - (28%)
Similarity:185/403 - (45%) Gaps:64/403 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPE--QIAHSFH 110
            |:.|:|.:.:.:.|.:||.|||.||.....|...||...|.|::.:.||...:|..  :|.|.|.
Human    49 FAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVEIQHGFQ 113

  Fly   111 QVLAA--YQDSQI-LRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQ--------SVDFSKNVQAA 164
            .::.:  :...:: |:|.|.:|:  |..|:.     |:| ||:..:        |.|||....|.
Human   114 HLICSLNFPKKELELQIGNALFI--GKHLKP-----LAK-FLNDVKTLYETEVFSTDFSNISAAK 170

  Fly   165 ATINNWVEQRTN----HLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTR-PDTFHLDG 224
            ..||:.||.:|.    .||:||.|..:      :||||.||||..|.:.|....|. ..:|.:|.
Human   171 QEINSHVEMQTKGKVVGLIQDLKPNTI------MVLVNYIHFKAQWANPFDPSKTEDSSSFLIDK 229

  Fly   225 ERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTG-LPALEEKLRLTTLSQ 288
            ..|||||||...|::.:.....|:...|::.|..:.|: |.|||  |.| :.::|..:...||.:
Human   230 TTTVQVPMMHQMEQYYHLVDMELNCTVLQMDYSKNALA-LFVLP--KEGQMESVEAAMSSKTLKK 291

  Fly   289 ITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVS-------- 345
            ..:.|.:..|.|.:|:|......:|.....|:|:...:|:.|:|..:.:. ..||:|        
Human   292 WNRLLQKGWVDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSGLTED-NGLKLSNRPAGFVL 355

  Fly   346 --AIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYV------LVHQKDLP 402
              ...|||.:.:.|:||||||...:.:        .::|...|. ||...:      |:.::...
Human   356 PTQAAHKAVLHIGEKGTEAAAVPEVEL--------SDQPENTFL-HPIIQIDRSFMLLILERSTR 411

  Fly   403 --LFWGSVVRLEE 413
              ||.|.||...|
Human   412 SILFLGKVVNPTE 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 113/396 (29%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 113/396 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.