DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpina12

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:422 Identity:110/422 - (26%)
Similarity:205/422 - (48%) Gaps:47/422 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLVPCGCWLLPLL---GLAL-FPFPPVHTADVTMADAAHQEFARRLAL----FSINVYGKLSGQK 60
            |::..|.:|..||   ||.. ...|.::.:.|.:.:...::.||:||.    |...:..:|:...
Mouse     3 RMLDLGLFLAGLLTVKGLLQDRDAPDMYDSPVRVQEWRGKKDARQLARHNMEFGFKLLQRLASNS 67

  Fly    61 PGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVL----AAYQDSQI 121
            |..||..||.||.|..:|..|||:|.|..::.:|..........:..:||.:|    ...:|:: 
Mouse    68 PQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSNWDVHAAFHYLLHKLNQETEDTK- 131

  Fly   122 LRIANKIFVMDGYQLRQEFDQLLSKQ--FLSAAQSV--------DFSKNVQAAATINNWVEQRTN 176
            :.:.|.:|:          ||.|..|  ||:.|::|        :|.........||.::.|:|:
Mouse   132 MNLGNALFM----------DQKLRPQQRFLNLAKNVYDADMVLTNFQDLENTQKDINRYISQKTH 186

  Fly   177 HLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRY 241
            ..||::|.:  ::..:.::|.|.|:|:|.||::|....|:.:.|.::..:||:||||..:..:..
Mouse   187 SRIKNMVKS--IDPGTVMILTNYIYFRGRWQYEFDPKQTKEEEFFIEKGKTVKVPMMFQRGLYDM 249

  Fly   242 ADLPALDAMALELPYKDSDLSMLIVLP-NTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRF 305
            |....|....||:||: .:::...||| |.|  |..||:.|:....::....|.:..|.:.:|:.
Mouse   250 AYDSQLSCTILEIPYR-GNITATFVLPDNGK--LKLLEQGLQADIFAKWKSLLSKRVVDVWVPKL 311

  Fly   306 KAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAV 370
            :......:.:|..:||:|::|.:..:..: :.|...|||...:|||.::::|:|.|.||.:|...
Mouse   312 RISSTYNMKKVLSRLGISKIFEENGDLTR-ISSHRSLKVGEAVHKAELKMDEKGMEGAAGSGAQT 375

  Fly   371 RRKRAIMSPEEPIEFFADHPFTYVLVHQKDLP 402
                  :..|.|.....|.|| .:::::..:|
Mouse   376 ------LPMETPRHMKLDRPF-LMMIYENFMP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 99/377 (26%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 97/374 (26%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.