DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpina5

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:368 Identity:106/368 - (28%)
Similarity:189/368 - (51%) Gaps:14/368 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLA-SSDPEQIAH-SFH 110
            |:..:|..|:.:.||:|:.|||.|:.....|..||:..:|..|:.:||||: ....|.:.| .|.
  Rat    83 FAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKTKAQILEGLGLSLQQGQEDMLHKGFQ 147

  Fly   111 QVLAAY---QDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVE 172
            |:|..:   .|...|.:.:.:|......:|..|...:...::|...|.:|.....|...||::|.
  Rat   148 QLLQQFSQPSDGLQLSLGSALFTDPAVHIRDHFLSAMKTLYMSDMFSTNFGNPESAKKQINDYVA 212

  Fly   173 QRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKE 237
            ::||..|.||:..  |:|...:|:||.|.||..||..|:...|....:|:..::|:|||||:.::
  Rat   213 KKTNGKIVDLIKD--LDSTHVMVVVNYIFFKAKWQTAFSSTNTHKMDYHVTPKKTIQVPMMNRED 275

  Fly   238 RFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKL 302
            .:.|.....:....:.:||:.:..: |.:|| ::..:..:|:.|...||....:...:.::.|.|
  Rat   276 IYSYILDQNISCTVVGIPYQGNTFA-LFILP-SEGKMKRVEDGLDERTLRNWLKMFTKRQLDLYL 338

  Fly   303 PRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATG 367
            |:|..|...:|.::..|||:..:|:..|:...:..... :|:|.::||:.:||:|.||.|||:||
  Rat   339 PKFSIEGTYKLEKILPKLGIQDIFTTHADLSGLTDHTN-IKLSEMVHKSMVEVDESGTTAAASTG 402

  Fly   368 MAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWGSVVR 410
            :....:.|..|..: :||  ..||..|::...:| .|.|.|::
  Rat   403 ILFTLRSARPSSLK-VEF--TRPFLVVIMDGTNL-YFIGKVIQ 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 105/364 (29%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 105/364 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.