DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINE3

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001094790.1 Gene:SERPINE3 / 647174 HGNCID:24774 Length:424 Species:Homo sapiens


Alignment Length:359 Identity:103/359 - (28%)
Similarity:160/359 - (44%) Gaps:17/359 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDP--EQIAHSFH 110
            |::::|..::..:...|.|.||..:.....:.:.|||..|..||...||....|.  :...|:.:
Human    33 FALHLYQSVAACRNETNFVISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDKRVKDFLHAVY 97

  Fly   111 QVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRT 175
            ..|........:.:|..:||..|..|...|.:.:|....|:.:..|.|:....|...:....:.|
Human    98 ATLPTSSQGTEMELACSLFVQVGTPLSPCFVEHVSWWANSSLEPADLSEPNSTAIQTSEGASRET 162

  Fly   176 NHLIKDLVPA-----DVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSL 235
            ........|.     .|..:.::||||:.:.|:|||:.:|:...|:...|.......:|||||..
Human   163 AGGGPSEGPGGWPWEQVSAAFAQLVLVSTMSFQGTWRKRFSSTDTQILPFTCAYGLVLQVPMMHQ 227

  Fly   236 KERFRYA---DLPALDAMALELPYKDSDLSMLIVLPNTK-TGLPALEEKLRLTTLSQITQSLYET 296
            .....|.   |........|||||..|.:|:.:|||..| |.|..:|..|..:|:...|.||...
Human   228 TTEVNYGQFQDTAGHQVGVLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTTSLRRA 292

  Fly   297 KVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTE 361
            ::.:.||||:.:.|..|..:....|::.:|.......|.:...:...||..||||.|||.||||:
Human   293 RMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGISGQDGFYVSEAIHKAKIEVLEEGTK 357

  Fly   362 AAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVL 395
            |:.||.:.:.::..|     || |.||.||.|.|
Human   358 ASGATALLLLKRSRI-----PI-FKADRPFIYFL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 103/359 (29%)
SERPINE3NP_001094790.1 SERPIN 31..399 CDD:238101 103/359 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..174 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.