DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpina3i

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:373 Identity:118/373 - (31%)
Similarity:188/373 - (50%) Gaps:37/373 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGL--GLASSDPEQIAHSFH 110
            |:.::|.||..:.|.||:|||||||.|..|:..|||::.|..::.:||  .|..:....|...|.
Mouse    79 FAFSLYRKLVLKNPDENVVFSPFSIFTALALLSLGAKSNTLKEILEGLKFNLTETPEPDIHQGFR 143

  Fly   111 ---QVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVE 172
               .:|:...|...:...:.:||....|:..||.:.....:.:.|.:.||.:..||...||::|.
Mouse   144 YLLDLLSQPGDQVQISTGSALFVEKHLQILAEFKEKARALYQAEAFTADFLQPCQAKKLINDYVS 208

  Fly   173 QRTNHLIKDLVPADVLNSESRLVLVNAIHFK--------------GTWQHQFAKHLTRPDTFHLD 223
            .:|...||:|: :| |:..:.:||||.|:||              |.|:..|....|....|:||
Mouse   209 NQTQGKIKELI-SD-LDKSTLMVLVNYIYFKGGRGHCLGVEREELGKWKMPFDPRDTFNSKFYLD 271

  Fly   224 GERTVQVPMMSLKE----RFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLT 284
            .:|:|:||||.::|    .||..:   |....:||.| ..:.|.|.:||: :..:..:|..|...
Mouse   272 EKRSVKVPMMKIEELTTPYFRDDE---LSCSVVELKY-TGNASALFILPD-QGKMQQVETSLHPE 331

  Fly   285 TLSQITQSLYETKVA-LKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAII 348
            ||.:...||..:::: |.||:|.......|..|...||:..:||.||:...:..:.: |:||.::
Mouse   332 TLRKWKNSLKPSRISELHLPKFSISNDYSLEHVLPVLGIREVFSMQADLSAITGTMD-LRVSQVV 395

  Fly   349 HKAFIEVNEEGTEAAAATGMAVR-RKRAIMSPEEPIEFFADHPFTYVL 395
            |||.::|.|.|||||||||:.|. |...|.|    :..:...||..::
Mouse   396 HKAVLDVTETGTEAAAATGVKVNLRCGKIYS----MTIYFKRPFLIII 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 118/373 (32%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 118/373 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.