DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and LOC569077

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:369 Identity:135/369 - (36%)
Similarity:202/369 - (54%) Gaps:18/369 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLAS-----SD 101
            :|..:||::::|..||......||.|||.||....:|..|||..:||.::::.|.|:|     |.
Zfish     5 SRANSLFALDLYQALSASSAEGNIFFSPLSISAVLSMVYLGARGDTAAEMERVLSLSSVSDVHSH 69

  Fly   102 PEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDF-SKNVQAAA 165
            .|.:..|.:...|:|    |||:||:::....:....|......|.:.:..|:||| ..:..:..
Zfish    70 FESLISSINSPSASY----ILRLANRLYGEKSFSFLPECLDSTMKLYHAELQTVDFIGASEGSRQ 130

  Fly   166 TINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQV 230
            .||.|||::|.:.|:||:...::.:.:||.|||||:|||.|.|.|....||...|.::.:.:..|
Zfish   131 LINKWVEKQTENKIRDLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFKINQKESHPV 195

  Fly   231 PMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPN-TKTG---LPALEEKLRLTTLSQIT- 290
            .||....:..:..||......|||||...:|||||:||: ||.|   |..||::|.|..|...| 
Zfish   196 RMMHQLNKLPFRCLPEYKLQVLELPYIQQELSMLILLPDETKDGSDPLLKLEKELTLEKLLDWTN 260

  Fly   291 QSLYETK--VALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFI 353
            :...:|:  |.:.||:||.|.:..|||..:|:|||.:|.:.......:.|...|.|||:|||||:
Zfish   261 RDKMDTQGAVIVHLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGMGSNGGLFVSAVIHKAFV 325

  Fly   354 EVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVH 397
            :|:||||||||||.:.:... .:..||....|.|||||.:.:.|
Zfish   326 DVSEEGTEAAAATCVYIITS-YVPRPEPRYYFTADHPFMFFIRH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 134/366 (37%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 135/369 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.