DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and serpinf2b

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001073479.1 Gene:serpinf2b / 563663 ZFINID:ZDB-GENE-061215-114 Length:479 Species:Danio rerio


Alignment Length:382 Identity:109/382 - (28%)
Similarity:183/382 - (47%) Gaps:66/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFH- 110
            ||..|:  |.|..:|  |::|||.|:....:...|||.|:|              .|.:.|..| 
Zfish   114 LFLENL--KPSPDQP--NVIFSPLSLSVALSQLALGATNDT--------------EELLLHHLHA 160

  Fly   111 QVLAAYQD--SQILR--------IANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAA 165
            ..|..|..  |.:||        ||::|::..|::.:.:|.:...|.:.|...::....:|    
Zfish   161 DALPCYHTALSSLLRNFRKRSMPIASRIYLKTGFKAKSDFMEDSQKLYDSEPATLTDVNDV---- 221

  Fly   166 TINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQV 230
              |.||::.||..|.:.:.:  |...:.::|:||:|:||.|..:|..|.|..:.|::|..:.|.|
Zfish   222 --NEWVKKVTNGHISEFLSS--LPPSAVMMLINAMHYKGEWLTRFDPHFTSTENFYIDENQIVNV 282

  Fly   231 PMMSLKERFRYADLP--ALDAMALELPYKDSDLSMLIVLPNT-KTGLPALEEKLRLTTL-SQITQ 291
            .|| |..::..:...  .|||.....|:| .|.|:|:|:|.: ...:.|:..||.::.| |::.:
Zfish   283 DMM-LGPKYPLSVFTHHELDAQVARFPFK-GDRSLLVVMPTSGHVNVSAIAAKLNISDLYSRLPR 345

  Fly   292 SLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFS----DQAEFGKMLQSPEPLKVSAIIHKAF 352
               |..:.:|||:||.:|..:|.|....:|:.::||    |:...|       ||.||::.|.:.
Zfish   346 ---ERNMQVKLPKFKLDFNQDLQEAMTSMGLGKLFSHPKLDRITEG-------PLFVSSVQHMSS 400

  Fly   353 IEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQ-KDLPLFWGSV 408
            :|:||||.||.|||.:.:.|...        .|..:.||.:.|:.. ...|||.|.:
Zfish   401 VEINEEGAEAVAATSVVISRSNP--------SFTVNQPFFFALMDDLSQTPLFLGVI 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 109/380 (29%)
serpinf2bNP_001073479.1 SERPIN 106..449 CDD:294093 109/380 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.