DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINB13

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:378 Identity:121/378 - (32%)
Similarity:182/378 - (48%) Gaps:43/378 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NIVFSPFSIQTCAAMARLGAENETATQLDQ------------------------GLGLASSDPEQ 104
            ||.|||..|.|...|..||....||:||::                        ..|....:.|.
Human    26 NIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVVRIKAEGKEIENTEA 90

  Fly   105 IAHSFHQVL---AAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAA-- 164
            :...|.:.|   :...:...|.|.|::|....|...|::...:.|.:.::.:.|||   |.||  
Human    91 VHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDF---VNAADE 152

  Fly   165 --ATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERT 227
              ..||:|||.:||..||||.|...::|.::|||||.::|||.|..:|.|..|:.:.|.::...:
Human   153 SRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTS 217

  Fly   228 VQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQ- 291
            ..|.||:....|.:..|..|.|..|.:|||::||||.::|||...||..:.:|:....|.:.|. 
Human   218 KSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSP 282

  Fly   292 -SLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSD-QAEFGKMLQSPEPLKVSAIIHKAFIE 354
             .:.|.||.|.||||:.|...:|..|...:||...||: :|::..| .|...|.....:|.:|:.
Human   283 GHMEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGM-SSGSGLYAQKFLHSSFVA 346

  Fly   355 VNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVH-QKDLPLFWG 406
            |.|||||||||||:..    .:.|.........:|||.:.:.| :.:..||:|
Human   347 VTEEGTEAAAATGIGF----TVTSAPGHENVHCNHPFLFFIRHNESNSILFFG 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 121/378 (32%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 121/378 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.