DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINB9

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:367 Identity:121/367 - (32%)
Similarity:187/367 - (50%) Gaps:29/367 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQV 112
            |:|.:...|....|..|:..||.||.:..||..|||:..||||:.|.|.|  :..|.|..:|..:
Human    11 FAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSL--NTEEDIHRAFQSL 73

  Fly   113 LAAYQDS---QILRIANKIFVMDGYQLRQEFD---------QLLSKQFLSAAQSVDFSKNVQAAA 165
            |.....:   .:||.||::|.....|....|.         :|....|:.||:        ::..
Human    74 LTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAE--------ESRK 130

  Fly   166 TINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQV 230
            .||.||.::|...|::|:|...:::|:||||||||:|||.|...|.:..||...|.::.|....|
Human   131 HINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPV 195

  Fly   231 PMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQ--SL 293
            .||..:..|:.|.:..:.|..|||||...:||:|::||:....|..:|:.|....|:..|:  .:
Human   196 QMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCM 260

  Fly   294 YETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSD-QAEFGKMLQSPEPLKVSAIIHKAFIEVNE 357
            ..|:|.:.||:||.:...::..|.:.||:...|.. :|:...| .:...|.:|..:||:|:||||
Human   261 KSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAM-SAERDLCLSKFVHKSFVEVNE 324

  Fly   358 EGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQK 399
            ||||||||:...|..:..:   |....|.|||||.:.:.|.:
Human   325 EGTEAAAASSCFVVAECCM---ESGPRFCADHPFLFFIRHNR 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 121/367 (33%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 121/367 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.