DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINE2

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_005246698.1 Gene:SERPINE2 / 5270 HGNCID:8951 Length:410 Species:Homo sapiens


Alignment Length:407 Identity:121/407 - (29%)
Similarity:199/407 - (48%) Gaps:23/407 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WLLPLLGLALFPFPPV--HTADVTMADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQ 73
            |.|||..||....|.:  |...:::.:.....        .|.|:.::...:|.:|||.||..|.
Human    15 WHLPLFLLASVTLPSICSHFNPLSLEELGSNT--------GIQVFNQIVKSRPHDNIVISPHGIA 71

  Fly    74 TCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQ 138
            :...|.:|||:..|..||...:....:...:|....::.:.:.::..|:.:||.:||.:..::..
Human    72 SVLGMLQLGADGRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEV 136

  Fly   139 EFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSE-SRLVLVNAIHF 202
            .|.......|....::|:|.....|..:||.||:..|..:|.:|:..|:::.. :|||||||::|
Human   137 PFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYF 201

  Fly   203 KGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAM---ALELPYKDSDLSML 264
            ||.|:.:|....|:..||.....::.||||::....||.....|.:.:   .:||||....:|||
Human   202 KGLWKSRFQPENTKKRTFVAADGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISML 266

  Fly   265 IVLP-NTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMF-S 327
            |.|| .:.|.|.|:...:...|:......:...:|.:.||:|.|..|.:|.|..:.||::.|| |
Human   267 IALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDS 331

  Fly   328 DQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFT 392
            .:|.|.|:....|.|.||.|:.||.|||:|:||:|:|||      ...:::...|..|..|.||.
Human   332 SKANFAKITTGSENLHVSHILQKAKIEVSEDGTKASAAT------TAILIARSSPPWFIVDRPFL 390

  Fly   393 YVLVHQ-KDLPLFWGSV 408
            :.:.|. ....||.|.:
Human   391 FFIRHNPTGAVLFMGQI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 113/369 (31%)
SERPINE2XP_005246698.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9820
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.