DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINB5

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_002630.2 Gene:SERPINB5 / 5268 HGNCID:8949 Length:375 Species:Homo sapiens


Alignment Length:372 Identity:96/372 - (25%)
Similarity:197/372 - (52%) Gaps:40/372 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQ------------GLGLASS 100
            |:::::.:|..::|..|::|||..:.|..::|::||:.:||.::.|            |....:|
Human    11 FAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTS 75

  Fly   101 DPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDF-SKNVQAA 164
            |..::: ||:.          |::..:::|.....|..||.....:.:....::||| .|..:..
Human    76 DVNKLS-SFYS----------LKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETK 129

  Fly   165 ATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQ 229
            ..|||.::..|:...::::..:.:|.::::::|||.:|.|.|..:|::..|:...|.::...|..
Human   130 GQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKP 194

  Fly   230 VPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLP----NTKTGLPALEEKLRLTTLSQIT 290
            |.||:::..|...::.:::...:|||:::..|||.|:||    :..|||..:|::|...:|||.|
Human   195 VQMMNMEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKIEKQLNSESLSQWT 259

  Fly   291 --QSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFS-DQAEFGKMLQSPEPLKVSAIIHKAF 352
              .::...||.|.:|:||.|..::.....:.||:..:|| |.::|..|.:: :.:.:|.:|||..
Human   260 NPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGMSET-KGVALSNVIHKVC 323

  Fly   353 IEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQK 399
            :|:.|:|.::....|..:.:.:.        |..|||||.|::.|.|
Human   324 LEITEDGGDSIEVPGARILQHKD--------ELNADHPFIYIIRHNK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 96/372 (26%)
SERPINB5NP_002630.2 maspin_like 4..375 CDD:239012 96/372 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.