DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINA4

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:442 Identity:126/442 - (28%)
Similarity:197/442 - (44%) Gaps:71/442 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLPLLGLALFPFPPVHTA--DVTMADAAHQE------------FARRLALFSINVYGKLSGQKPG 62
            ||.|:||.......:|..  ..:.::::||:            .|...|.|:...|..::.:.||
Human    45 LLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPG 109

  Fly    63 ENIVFSPFSIQTCAAMARLGAENETATQLDQGLG-----LASSDPEQ-IAHSFHQVLAAYQDSQI 121
            :||.|||.||....||..|||.:.:.:|:.:|||     |:.||..: ..|..|.:.......: 
Human   110 KNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLE- 173

  Fly   122 LRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSV--------DFSKNVQAAATINNWVEQRTNHL 178
            .|:.:.:|:  .:.|:     .|:| ||:...:|        :|...|.....||:.|::.|...
Human   174 TRVGSALFL--SHNLK-----FLAK-FLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGK 230

  Fly   179 IKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMM-SLKERFRYA 242
            |.|||  ..|..:..:||||.|:||..|:..|....|.|..|::|...||:|||| ..:|...|.
Human   231 IVDLV--SELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYL 293

  Fly   243 DLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSL----YETKVALKLP 303
            ....|....|.:.|| .|.::..:||| :..:..:||.|....|.:....|    :..|:.|.||
Human   294 HDRYLPCSVLRMDYK-GDATVFFILPN-QGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLP 356

  Fly   304 RFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGM 368
            :|.......|.::..:||.:.:||..|:...:.:. :.|:.|...|||.::|:|.||||||||..
Human   357 KFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQ-QKLEASKSFHKATLDVDEAGTEAAAATSF 420

  Fly   369 AVRRKRAIMSPEEPIEFFA----------DHPFTYVLVH-QKDLPLFWGSVV 409
            |             |:||:          :.||..|:.. .....||.|.||
Human   421 A-------------IKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 115/392 (29%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 115/393 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.