DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINA5

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:384 Identity:109/384 - (28%)
Similarity:192/384 - (50%) Gaps:22/384 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TMADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLG 96
            |:|.::.::       |:.::|..|:...|.::|.|||.||....||..|||.:.|..|:.:|||
Human    39 TVAPSSRRD-------FTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLG 96

  Fly    97 --LASSDPEQIAHSFHQVLAAY---QDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVD 156
              |..|..:::...|.|:|...   :|...|.:.|.:|......|:..|...:...:|:.....:
Human    97 LNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTN 161

  Fly   157 FSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFH 221
            |..:..|...||::|.::|...|.||:..  |:|.:.:::||.|.||..|:..|....|:...|:
Human   162 FRDSAGAMKQINDYVAKQTKGKIVDLLKN--LDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFY 224

  Fly   222 LDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTL 286
            :..|..|:|||||.::::.|.....|....:.:||: .:.:.|.:|| ::..:..:|..|...||
Human   225 VTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQ-GNATALFILP-SEGKMQQVENGLSEKTL 287

  Fly   287 SQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKA 351
            .:..:...:.::.|.||:|..|...:|.:|...||:|.:|:..|:... :.:...::||.::|||
Human   288 RKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSG-ISNHSNIQVSEMVHKA 351

  Fly   352 FIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWGSVVR 410
            .:||:|.||.||||||.....:.|.::.:..:   .:.||...:|...  .||.|.|.|
Human   352 VVEVDESGTRAAAATGTIFTFRSARLNSQRLV---FNRPFLMFIVDNN--ILFLGKVNR 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 105/367 (29%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 105/375 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.