DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINE1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:404 Identity:129/404 - (31%)
Similarity:191/404 - (47%) Gaps:36/404 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLGLAL-------FPFPPVHTADVTMADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSI 72
            :|||||       ...||.:.|.:. :|            |.:.|:.:::......|:||||:.:
Human    11 VLGLALVFGEGSAVHHPPSYVAHLA-SD------------FGVRVFQQVAQASKDRNVVFSPYGV 62

  Fly    73 QTCAAMARLGAENETATQLDQGLGLASSD---PEQIAHSFHQVLAAYQDSQILRIANKIFVMDGY 134
            .:..||.:|....||..|:...:|....|   ...:.|.:.:::..:...:| ...:.|||....
Human    63 ASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEI-STTDAIFVQRDL 126

  Fly   135 QLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNA 199
            :|.|.|.....:.|.|..:.||||:..:|...||:||:..|..:|.:|:....::..:|||||||
Human   127 KLVQGFMPHFFRLFRSTVKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNA 191

  Fly   200 IHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAM---ALELPYKDSDL 261
            ::|.|.|:..|....|....||.....||.||||:...:|.|.:....|..   .|||||....|
Human   192 LYFNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTL 256

  Fly   262 SMLIVLPNTK-TGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRM 325
            ||.|..|..| ..|.||...|....:|....::......|.||:|..|.:|:|.:..:.|||:.|
Human   257 SMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDM 321

  Fly   326 FSD-QAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADH 389
            |.. ||:| ..|...|||.|:..:.|..|||||.||.|:::|.:.|   .|.|:|||.|   .|.
Human   322 FRQFQADF-TSLSDQEPLHVAQALQKVKIEVNESGTVASSSTAVIV---SARMAPEEII---MDR 379

  Fly   390 PFTYVLVHQKDLPL 403
            ||.:|:.|....||
Human   380 PFLFVVRHNPTGPL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 120/367 (33%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 120/384 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.