DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and serpinb5

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001011282.1 Gene:serpinb5 / 496735 XenbaseID:XB-GENE-5802997 Length:379 Species:Xenopus tropicalis


Alignment Length:380 Identity:110/380 - (28%)
Similarity:197/380 - (51%) Gaps:42/380 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ARRLA--LFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQL------------D 92
            |.|||  ..:::::.||..:...:|.|.||..|.:..::.|.|::..||::|            |
 Frog     3 ALRLANTALAVDIFKKLCEKSATDNFVCSPLCISSSLSLIRKGSQGNTASELEKALHFEKVKDPD 67

  Fly    93 QGLGLASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDF 157
            .|..|.|||..:|:           .:..|::..:::|.:..:.:::|.....|.:....:::||
 Frog    68 FGFQLLSSDISKIS-----------SANSLKLLKRVYVDNSIECKKDFINSAKKPYPLELETIDF 121

  Fly   158 SKNVQAAAT-INNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFH 221
            ....:.|.| ||:.|::.|:...:.::.....:..::::::.|..|||.|.:.|.|..|:...||
 Frog   122 KSQAEEARTQINSSVKELTDGNFETVLNEGSCDENTKIIMLGAASFKGKWVYTFNKSETKEMDFH 186

  Fly   222 LDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLP----NTKTGLPALEEKLR 282
            ::.:.|..|.||.|:.|.....:..|..|.||:|::....||||:||    :..|||..||:.:.
 Frog   187 INKKETKPVQMMHLEARLSIGYINELKTMVLEMPFQSKHFSMLILLPKDIEDDSTGLKKLEQDMT 251

  Fly   283 LTTLSQIT--QSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQA-EFGKMLQSPEPLKV 344
            ....:..|  ..:..:||.:.||:||.|...:|.::.:.||::..|:::| :|.:|.:| :.:.:
 Frog   252 FEKYTHWTNPSMMANSKVKVSLPKFKMENSYDLKDMLKSLGINDAFNEEASDFSEMTES-KGISI 315

  Fly   345 SAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQK 399
            |..|.||.|||:|:|||:|     .|..:|.:|:.|   ||.|||||.|:|.|.|
 Frog   316 SQAIQKACIEVDEDGTESA-----DVSMERRLMNKE---EFLADHPFIYILRHNK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 108/377 (29%)
serpinb5NP_001011282.1 serpinB5_maspin 1..375 CDD:381013 110/380 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.