DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and serpinc1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001008153.1 Gene:serpinc1 / 493515 XenbaseID:XB-GENE-975782 Length:456 Species:Xenopus tropicalis


Alignment Length:401 Identity:123/401 - (30%)
Similarity:192/401 - (47%) Gaps:55/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EFARRLALFSINVYGKLSGQKPG-ENIVFSPFSIQTCAAMARLGAENETATQLDQGL---GLASS 100
            |.::..|.|:|..|..|:..|.. |||..||.||.....||:|||.|.|..:|.:..   .::..
 Frog    73 ELSQANAKFAIAFYKNLADSKQNTENIFMSPLSISQAFTMAKLGACNNTLKELMEVFYFDTISER 137

  Fly   101 DPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQ--- 162
            ..:||.:.|     |..:.::.|.|||            ..:|:|...|...:|:.|::..|   
 Frog   138 ASDQIHYFF-----AKLNCRLFRKANK------------SSELVSVNRLFGEKSLTFNETYQDIS 185

  Fly   163 -------------------AAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQH 208
                               :...|||||..:|...|.|::|..|:..::.|||:|||:|||.|:.
 Frog   186 ELVYGAKLLPLNFKEKPELSREIINNWVSDKTEKRITDVIPVGVITPDTVLVLINAIYFKGLWKS 250

  Fly   209 QFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTG 273
            :|....|:.:.|:.|.........|..:..|||:.........||||||..|::|::|||:.:|.
 Frog   251 KFNSENTKMEQFYPDESNHCLAATMYQEGIFRYSSFKDDGVQVLELPYKGDDITMVLVLPSPETP 315

  Fly   274 LPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFS-DQAEF-GKML 336
            |..:|:.|.|..|....|...|.::::.||||:.|....:.|..|::|:..:|. :.|:. |.:.
 Frog   316 LMKVEQNLTLEKLGNWLQKSRELQLSVYLPRFRVEDSFSVKEKLQQMGLVDLFDPNSAKLPGIVA 380

  Fly   337 QSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDL 401
            .....|.||...||||:||||||:||||:|.:.:..:...::   .|.|.|:.||   ||..:::
 Frog   381 GGRTDLYVSDAFHKAFLEVNEEGSEAAASTAVILTGRSLNLN---RITFRANRPF---LVFIREV 439

  Fly   402 P----LFWGSV 408
            .    ||.|.|
 Frog   440 AINSVLFMGRV 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 121/394 (31%)
serpinc1NP_001008153.1 serpinC1_AT3 61..455 CDD:381002 123/401 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.