DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and serpinf1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001004539.1 Gene:serpinf1 / 447800 ZFINID:ZDB-GENE-040912-2 Length:406 Species:Danio rerio


Alignment Length:416 Identity:102/416 - (24%)
Similarity:188/416 - (45%) Gaps:42/416 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLGL-ALFPFPPVHTADVTMADAAHQ----------EFARRLALFSINVYGKLSGQKPGENIVFS 68
            |:|| :|........||.|.|:...:          :.|...:.|..|::.:|:.:....::..|
Zfish     7 LVGLWSLLSLSHAQLADTTDAEGEEEAVDLFTTPRTKLAAATSDFGYNLFRQLASRDTKASVFLS 71

  Fly    69 PFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAYQDS-QILRIANKIFVMD 132
            |.||........:||......|:.:.|...:....|:..:...:|::.:.| :..:.|.:|.:..
Zfish    72 PMSISAAFTQLSMGASERAEKQIYRALRYHTLQDSQLHDTLRDLLSSLRASAKGFKSAERILLAR 136

  Fly   133 GYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLV 197
            ..:||.|:...:.||:....|.:  :...:...|:|:|.:|:|...:..:||:. |...:.|:.|
Zfish   137 KLRLRLEYLNSVEKQYGERPQIL--AGGARDLKTVNDWFKQQTGGKVDQVVPSP-LPRNTALLPV 198

  Fly   198 NAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDA----MALELPYKD 258
            .:.:|||.|..:|.|. .:.:||..||:....:|||   |:..|.....:|:    ...::|.:|
Zfish   199 GSAYFKGKWITRFGKP-NKMETFRRDGQAPAVIPMM---EQENYPVKMGIDSDLGCTIAQVPMED 259

  Fly   259 SDLSMLIVLPNTKT-GLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGM 322
            . :||...||:..| .|..:||.|....:..::.||:..||.|.||..|..::..|......||:
Zfish   260 G-VSMYFFLPDEVTQNLTLIEEALTAEFVQDLSNSLHTVKVLLTLPVIKLSYKTNLLPSLSDLGL 323

  Fly   323 SRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFA 387
            |...: :.:..|:  :.:|:|::|:.||..:|...||.|.|:.|..|..:...       :.:..
Zfish   324 SEWLA-ETDLTKI--TSQPVKLNAVHHKVVLETAPEGAEYASTTPSATGQSLG-------LSYRV 378

  Fly   388 DHPFTYVLVHQKDLP----LFWGSVV 409
            |.||.:::   :|.|    ||.|.|:
Zfish   379 DRPFLFLV---RDEPSGALLFIGKVL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 92/372 (25%)
serpinf1NP_001004539.1 SERPIN 30..403 CDD:294093 94/393 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.