DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Spn100A

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:376 Identity:90/376 - (23%)
Similarity:166/376 - (44%) Gaps:76/376 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ENETATQLDQ------GLGLASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDG---YQLRQE 139
            ||||..:.::      ...|.:.:||::....          |.|..|.|....||   ..|..|
  Fly   305 ENETVQEEEKLAKIMAAPALTAGEPEKVRLPL----------QKLENAVKTAAKDGADEIMLALE 359

  Fly   140 FDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKG 204
             ..|.|...::.|:|:....::.:|.:.|:             :......|:|:::|.|.::::|
  Fly   360 -SHLPSVSRVNGARSLFQQDDITSALSANS-------------ITGRSAGSKSKMLLFNGLYYRG 410

  Fly   205 TWQHQFAKHLTRPDT-FHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLP 268
            :|.:.|.:.....|. |.:..|..|:.|||..:.:|:.||||.:.|..|.|||:.|..::.||||
  Fly   411 SWANPFYQLRDGSDEFFFMTNEDAVKAPMMHARGKFQVADLPQVKARVLSLPYETSRYALCIVLP 475

  Fly   269 NTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFS-DQAEF 332
            :...||..:..:|:.:......:.....::.:.:|:|:.|.......:.:::|:.::|| .:|:.
  Fly   476 DETEGLSDVISQLQTSDFLLAKKQFQMKELHISMPKFQVEETSRSEAMLKQMGLKKVFSRTEAQL 540

  Fly   333 GKMLQSPEPLKVSAIIHKAFIEVNEEGTEA---AAATGMAVRRKRAIMS---------PEEP-IE 384
            ..:.:.|: :.|..|:....:.|:|.|:.|   :|||..|  |..::.|         ||.| :|
  Fly   541 SLLSEDPD-VHVDEIVQFVNVRVDEGGSSANSLSAATMQA--RTPSVESTVLPVPEPEPELPGVE 602

  Fly   385 -FFADHPFTYVLV-----------------HQKDLPLFWGSV---VRLEEN 414
             |..:.||.|.:|                 .::|||    ||   |.||::
  Fly   603 RFEVNRPFAYFIVDCQEQFVLASGKIYTPEFKEDLP----SVSIEVELEQS 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 85/365 (23%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 63/263 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.