DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Spn77Ba

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:422 Identity:105/422 - (24%)
Similarity:191/422 - (45%) Gaps:49/422 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALFPFPPVHTADVTMADAAHQEF--------ARRLALFSINVYGKLS--GQKPGENIVFSPFSI 72
            |..|..|....:.|:...:....|        ::.:..|::::..::|  .:|..::.:.||||:
  Fly    41 LTAFTAPTAFQSGVSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSV 105

  Fly    73 QTCAAMARLGAENETATQLDQGLGLASSDPE-----QIAHSFHQVLAAYQDSQILRIANKIFVMD 132
            .:...:...|:|.||..||.:.|.:...|.:     ::..||..:..:..:...|:   .|:...
  Fly   106 WSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKVWSSFLNITTSTIEVATLQ---AIYTGK 167

  Fly   133 GYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSE---SRL 194
            ||.::..:...: :.:......||| .:..:...||    :.||...:.|:|..:|..:   :::
  Fly   168 GYPIKNNYRDAI-QNYNVQPMEVDF-YSPDSVIQIN----EDTNRTTRGLIPYTILPQDVYGAKM 226

  Fly   195 VLVNAIHFKGTWQHQFAKHLTRPDTFHLD-GERTVQVPMMSLKERFRY-ADLPALDAMALELPYK 257
            .|:::::|||.|:..|.|.|||.:.|..: ||...::|||..:..|.| :::..||...|||||.
  Fly   227 FLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYG 291

  Fly   258 DSD-LSMLIVLPNTKTGLPALEEKLRLTTLSQITQSL--------YETKVALKLPRFKAEFQVEL 313
            ..| |:|::|||.....|..:...|:...|..|.|.|        .:.:|.:.:|:|.......|
  Fly   292 TQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTL 356

  Fly   314 SEVFQKLGMSRMFSDQ-AEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIM 377
            ..|..::|:..:|.:. |...:|...   |....::|...|.|:|:||.|.|.|..|:..|..  
  Fly   357 KGVLIQMGIRDLFDENTANLDRMSSG---LFAKLVVHSTKIIVDEQGTTAGAVTEAALANKAT-- 416

  Fly   378 SPEEPIEFFADHPFTYVLVHQ-KDLPLFWGSV 408
                |.:|..:.||.|::|.: ..|.||.|.|
  Fly   417 ----PPKFLLNRPFQYMIVEKATGLLLFAGQV 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 99/385 (26%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 99/386 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
54.950

Return to query results.
Submit another query.