DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and AT1G62160

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:194 Identity:56/194 - (28%)
Similarity:78/194 - (40%) Gaps:45/194 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PMMSLKERFRYADLPALDAM-ALELPYK------DSDLSMLIVLPNTKTGLPALEEKLRLTT--L 286
            |.|...:.|....:.|.|.. .|.|||:      :.:.||...||:.|..|..|.:::..|.  |
plant    51 PKMRGHKNFEKQYIAAYDGFKVLRLPYRQGRDNTNRNFSMYFYLPDKKGELDDLLKRMTSTPGFL 115

  Fly   287 SQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKA 351
            ...|..........::|:||.||..|.|.||....:...|                     ..||
plant   116 DSHTPRERVEVDEFRIPKFKIEFGFEASSVFSDFEIDVSF---------------------YQKA 159

  Fly   352 FIEVNEEGTEAAAATGMAVRRKRAIMSPE------EPIEFFADHPFTYVL-VHQKDLPLFWGSV 408
            .||::||||||||||        |.:..|      |.::|.|||||.::: ..|....||.|.:
plant   160 LIEIDEEGTEAAAAT--------AFVDNEDGCGFVETLDFVADHPFLFLIREEQTGTVLFAGQI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 56/192 (29%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 56/194 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.