DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and serpind1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_878300.1 Gene:serpind1 / 359841 ZFINID:ZDB-GENE-030711-2 Length:507 Species:Danio rerio


Alignment Length:388 Identity:110/388 - (28%)
Similarity:184/388 - (47%) Gaps:48/388 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ALFSINVYGKLSGQ-KPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSF 109
            |.|...:|.||..: ...:||:.:|..|.....|..||....|..||.|.:|.|    |.:..|.
Zfish   139 ARFGFRLYRKLRNRLNQTDNILLAPVGISIAMGMMGLGVGPNTQEQLFQTVGFA----EFVNASN 199

  Fly   110 HQVLAAYQDSQI-------------------LRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSV 155
            |     |.:|.:                   ||..|.::|....|::..|.......:.:..|||
Zfish   200 H-----YDNSTVHKLFRKLTHRLFRRNFGYTLRSVNDLYVKRNVQIQDSFRADAKTYYFAEPQSV 259

  Fly   156 DFSKN---VQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRP 217
            ||:..   |:|    |..:::.|..|||:  |...::....::|:|.::|||||:.:|.|.||..
Zfish   260 DFADPAFLVKA----NQRIQKITKGLIKE--PLKSVDPNMAVMLLNYLYFKGTWEQKFPKELTHH 318

  Fly   218 DTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLR 282
            ..|.::.::.|:|.||..|..:..|....|:...|:|||. .::||||.:|...:|:.:||:::.
Zfish   319 RQFRVNEKKQVRVLMMQNKGSYLAAADHELNCDILQLPYA-GNISMLIAVPQKLSGMRSLEQEIS 382

  Fly   283 LTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAI 347
            .|.:::...::......:..||||.|...:|.|..:::||:.:|:::.:|..|  :.|.:.::..
Zfish   383 PTLVNKWLSNMTNRTREVVFPRFKLEQNYDLIEHLKEMGMTDIFTEKGDFSPM--TSEKVIINWF 445

  Fly   348 IHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLV-HQKDLPLFWGSVV 409
            .|:..|.||||||||||.|.:      ..|.......|..|.||.:::. |:....:|.|.||
Zfish   446 KHQGSITVNEEGTEAAAMTHI------GFMPLSTQTRFIVDRPFLFLIYEHRTGCVVFMGRVV 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 108/385 (28%)
serpind1NP_878300.1 HCII 61..505 CDD:239002 110/388 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.