DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and CG43366

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster


Alignment Length:511 Identity:104/511 - (20%)
Similarity:175/511 - (34%) Gaps:160/511 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PPVH-----------TADVTMADAAHQEFARRLALFSINVYGKLSGQK--PGENIVFSPFSIQTC 75
            |||.           .|...|.|...|.|||.....:.:.:..::.:|  ...::|.|||::.:.
  Fly  1654 PPVKLDPSPESSQGLEASTAMMDEDLQSFARLCNELAFSYWRAITSEKISSARSLVISPFALTSM 1718

  Fly    76 AAMARLGAENETATQLDQGLGL---ASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLR 137
            .:|..|||...|:.::::.|.|   .:.:|..|   |..:..:.:.:....||...||.:.:..|
  Fly  1719 LSMVFLGARGSTSGEMNEILKLDDMVTFNPHLI---FKNITNSVEQASDSDIATAAFVREIFSDR 1780

  Fly   138 QE------FDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVL-----NS- 190
            ..      |.:...:.:....:.|:|.       .:|:.|.:|||.|:|......||     || 
  Fly  1781 ANGKILPFFKEKTQQLYAGHVEEVNFH-------VVNDIVRRRTNLLVKRHTMGKVLEYLRTNSV 1838

  Fly   191 --ESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGE------------RTVQVPMMSLKERFRY 241
              ...|..::|..|:....|        ..|...|||            |.|.:|.:..:..|..
  Fly  1839 WVNGPLATISANLFQTDCSH--------GSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLA 1895

  Fly   242 ADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETK--------- 297
            ...|:|||..:......:.:|.:.|:|..::.:..::      .|.::.:||.||.         
  Fly  1896 GYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMD------NLDRLERSLVETAFSDKQAWRR 1954

  Fly   298 ----------VALKLPRFKAEFQVELSEVFQKLGMSRMF--------------------SDQAEF 332
                      :.::||||.....|..|...||:|:..:|                    ||..:.
  Fly  1955 LLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQI 2019

  Fly   333 G----------------KMLQSPEPLK-----VSAIIHKAFIEVNEEGTEAAAATGMAVR----- 371
            .                :|..:| ||:     |.|....||     :.:|.....|..|:     
  Fly  2020 NTFSTCGEEKISEHHHVEMYPAP-PLRKRNKDVDATDDDAF-----DSSERVVDFGSLVQESALG 2078

  Fly   372 -------------------RKRAIMSPEEP-IEFFADHPFTYVLVHQ-KDLPLFWG 406
                               |.|....|:.| :.|  |.||.|.:.|. ..:.||.|
  Fly  2079 RGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRF--DKPFLYFVRHNPTGMILFMG 2132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 94/479 (20%)
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 94/478 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.