DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and RGD1562844

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:249 Identity:86/249 - (34%)
Similarity:140/249 - (56%) Gaps:7/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAAT-INNWVEQRTNHLIKDLVPA 185
            ||:||.|||....::...|.:...:.:.|..:.:.|::..:.:.. :|.||.::|...|.:|:|.
  Rat    36 LRMANGIFVDKTCEVLPTFKESCLRFYNSEMEQLSFAEAAEESRKHVNTWVSKQTEGKIPELLPD 100

  Fly   186 DVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAM 250
            |.::.::|||||||::.|.||..||.:..||...|.::...|..|.||..:..|.|..:..:.|.
  Rat   101 DSVDFQTRLVLVNALYLKATWGRQFDEGSTREMPFKINKNETRPVQMMYQEGIFCYKYVKEVPAS 165

  Fly   251 ALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQ--SLYETKVALKLPRFKAEFQVEL 313
            .|.:|||..:|..|::||:....:..:||:|....|:..||  ::..|.|.:.||:||.|...:|
  Rat   166 LLMIPYKGDELCFLVLLPDESVDISKVEEELTFEKLTAWTQPDTMSYTHVEVFLPKFKLEEDYDL 230

  Fly   314 SEVFQKLGMSRMFSD-QAEFGKMLQSPE-PLKVSAIIHKAFIEVNEEGTEAAAA 365
            ..:.|:||:...|.: :|:...|  :|| .|.||..:||:.:||||:|||||||
  Rat   231 KSLLQRLGIVDAFEETKADLSAM--APERNLCVSKFVHKSVVEVNEKGTEAAAA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 86/249 (35%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm12319
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.