DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinb9d

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:339 Identity:109/339 - (32%)
Similarity:185/339 - (54%) Gaps:17/339 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 MARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLA----AYQDSQILRIANKIFVMDGYQLRQ 138
            |..|||:.:||.|:.|.|.| :..|::..|...|:|.    ..:....|||||::|..:..:|..
  Rat     1 MVLLGAKGDTAVQISQALNL-NKHPDEDIHKDFQLLLHNLNKPKSHYCLRIANRLFAENTCKLVP 64

  Fly   139 EFDQLLSKQFLSAAQSVDFSKNVQAAAT-INNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHF 202
            .:.:...:.:.|..:.:.|:|..:.:.. ||.||.::|...|.:|:.:|.:.||::|::|||::|
  Rat    65 TYKESCLRFYNSEIEQLSFAKAAEESRKHINTWVSKQTEGKIPELLSSDSVGSETKLIMVNALYF 129

  Fly   203 KGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVL 267
            :|:|.|.|.|..|....|.::.:.|..|.||..:|.|..|.:..:.|..|.:||:..::|.:::|
  Rat   130 QGSWLHCFDKEFTMEMPFKINKKETKPVQMMWQEETFDVAYVKEIQAQILVMPYRGMEMSFMVLL 194

  Fly   268 PNTKTGLPALEEKLRLTTLSQIT--QSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSD-Q 329
            |:....:..:|..|....|:..|  :.:|.|:|.:.||:|:.:.|.:::.:||.|||..:||: :
  Rat   195 PDEGVDIRKVESSLTFEKLTAWTKPEFIYSTEVYVYLPKFQLQEQYDMTALFQHLGMIDVFSEIK 259

  Fly   330 AEFGKMLQSPE-PLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTY 393
            |:...|  .|| .|.||..:|:..:||||||||||||:........:..:|    .|.||.||.:
  Rat   260 ADLSGM--CPEKDLCVSKFVHECVVEVNEEGTEAAAASAADCCYSCSEYTP----TFCADRPFLF 318

  Fly   394 VLVH-QKDLPLFWG 406
            .:.| |.:..||.|
  Rat   319 FIRHNQTNSILFCG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 109/339 (32%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 109/339 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm12319
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.