DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPIND1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:386 Identity:107/386 - (27%)
Similarity:174/386 - (45%) Gaps:46/386 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ALFSINVYGKLSGQ-KPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAH-- 107
            |.|:.|:|..|..| ...:||..:|..|.|...|..||.:.||..|:           ..|.|  
Human   131 AKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQV-----------HSILHFK 184

  Fly   108 SFHQVLAAYQDSQI----LRIANKIFVMD-GYQLRQEFDQLLSKQF--------------LSAAQ 153
            .|....:.|:.:.|    .::.:::|..: ||.||...|..:.|||              .:.||
Human   185 DFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQ 249

  Fly   154 SVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPD 218
            ..|||.....:.| ||.:.:.|..||||.:  :.::..::::::|.|:|||:|.::|...:|...
Human   250 IADFSDPAFISKT-NNHIMKLTKGLIKDAL--ENIDPATQMMILNCIYFKGSWVNKFPVEMTHNH 311

  Fly   219 TFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRL 283
            .|.|:....|:|.||..|..|..|:...||...|:|.|. ..:|||||:|:..:|:..||.:|..
Human   312 NFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYV-GGISMLIVVPHKMSGMKTLEAQLTP 375

  Fly   284 TTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAII 348
            ..:.:..:|:......:.||:||.|....|.|..:.:|:..:|........:  |.:.:.:....
Human   376 RVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDKNGNMAGI--SDQRIAIDLFK 438

  Fly   349 HKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLV-HQKDLPLFWGSV 408
            |:..|.||||||:|...|.:      ..|.....:.|..|.||.:::. |:....||.|.|
Human   439 HQGTITVNEEGTQATTVTTV------GFMPLSTQVRFTVDRPFLFLIYEHRTSCLLFMGRV 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 106/384 (28%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 107/386 (28%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.