DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpina16

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_853661.2 Gene:Serpina16 / 299271 RGDID:727888 Length:415 Species:Rattus norvegicus


Alignment Length:377 Identity:90/377 - (23%)
Similarity:159/377 - (42%) Gaps:47/377 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVPCGCWLLPLLGLALFPFPP--VHTADVTMADAAHQEFARRLALFSINVYGKLSGQKPGENIVF 67
            ||||.|       ....|.||  .:.:.:.:...|...|..:  .|::::|.:|...|.|:|::|
  Rat    15 LVPCSC-------DPQTPPPPEASNMSQIPVTQGAPPFFNNQ--KFALSLYKQLPQPKRGKNLIF 70

  Fly    68 SPFSIQTCAAMARLGAENETATQLDQGLG--LASSDPEQIAHSFHQVLAAYQDSQILRIAN---- 126
            ||..|.....:.....:.:...|:.|.||  :..:...:.|..:.::|     |.:|...|    
  Rat    71 SPLGIIVPLVLLAFQDKPKARHQVLQDLGFTVTGALDTKAASEYGKLL-----SNLLHTKNCGIY 130

  Fly   127 ---KIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVL 188
               .:|:....:..:.|.:|.:..:.|....:.|.....|...|:..:..||:..|..|:  .:|
  Rat   131 TGSLLFIDKTLKPAKTFVKLANSSYNSNVVLISFGNYGLAQKQIDLAIRARTHGKITKLL--RIL 193

  Fly   189 NSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHL-DGERTVQVPMMSLKERFRYADLPALDAMAL 252
            ...:.|.|.|...|||.|::.|.:..||...|.| ||.:|: ||||.....|:......:.:..|
  Rat   194 KPPTNLFLANYNFFKGKWKYPFNRKHTRMRYFWLEDGTKTL-VPMMQRVGWFQLQYFSQMHSYVL 257

  Fly   253 ELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYET--------KVALKLPRFKAEF 309
            :||:..| :|.:..||:        :.|...:..:.:.|| :||        |..|..|:|....
  Rat   258 QLPFTCS-ISGVFFLPD--------DGKFEESEKALLEQS-FETWIQPFPMSKRWLFFPKFSIPV 312

  Fly   310 QVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTE 361
            .:.|..:.......::||:..:..::.....||.||..:|:..:.|||:|.|
  Rat   313 ALHLENLKHVNSNIKLFSEHMDLSRITLQKAPLTVSTAVHRVELTVNEDGEE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 80/335 (24%)
Serpina16NP_853661.2 serpinA16_HongrES1-like 40..406 CDD:381053 82/345 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.