DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpina6

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:429 Identity:103/429 - (24%)
Similarity:185/429 - (43%) Gaps:61/429 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDYRLVPCGCWLLPLLGLALFPFPPVHTADVTMADA-------AHQEFARRLALFSINVYGKLSG 58
            |...|..|..||.              |:.:..|.|       :|:..|.....|:.|:|.:|..
  Rat     1 MSLALYTCLLWLC--------------TSGLWTAQASTNESSNSHRGLAPTNVDFAFNLYQRLVA 51

  Fly    59 QKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLG--LASSDPEQIAHSFHQV--LAAYQDS 119
            ..|.:|.:.||.||....||..||:   ..||..|.||  |..:...:|..||..:  |....|:
  Rat    52 LNPDKNTLISPVSISMALAMVSLGS---AQTQSLQSLGFNLTETSEAEIHQSFQYLNYLLKQSDT 113

  Fly   120 QI-LRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRT----NHLI 179
            .: :.:.|.:|::...:|:..|...:.:.:.|.|.::||....:|:..||..|:.:|    .|:.
  Rat   114 GLEMNMGNAMFLLQKLKLKDSFLADVKQYYESEALAIDFEDWTKASQQINQHVKDKTQGKIEHVF 178

  Fly   180 KDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADL 244
            .|      |:|.:..:|||.|..:|.|:..|:...||.:.|:::...||:||||.......|...
  Rat   179 SD------LDSPASFILVNYIFLRGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRD 237

  Fly   245 PALDAMALELPYKDSDLSMLIVLPN---TKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFK 306
            .......:::.|..:..:..| ||:   ..|.:.||..    .|:.:..:.:...:|.|.:|:|.
  Rat   238 SVFPCQLIQMDYVGNGTAFFI-LPDQGQMDTVIAALSR----DTIDRWGKLMTPRQVNLYIPKFS 297

  Fly   307 AEFQVELSEVFQKLGMSRMFSDQAEF-GKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAV 370
            .....:|.::.:.|.:..:.::|::| |.....|..|   .::|||.::: :||.....:|..|.
  Rat   298 ISDTYDLKDMLEDLNIKDLLTNQSDFSGNTKDVPLTL---TMVHKAMLQL-DEGNVLPNSTNGAP 358

  Fly   371 RRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWGSVV 409
            ...|:     ||::...:.||..:|..:    ..|.|::
  Rat   359 LHLRS-----EPLDIKFNKPFILLLFDK----FTWSSLM 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 92/375 (25%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 93/379 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.