DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serping1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_954524.1 Gene:Serping1 / 295703 RGDID:735225 Length:504 Species:Rattus norvegicus


Alignment Length:409 Identity:112/409 - (27%)
Similarity:188/409 - (45%) Gaps:56/409 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LFPFPPVHTADVTMADAAHQEFARRLALFSINVYGKLSGQKPGE-NIVFSPFSIQTCAAMARLGA 83
            |.|.|....:| :..|::....:..|..||:.:|...|..|..| |:.||||||.:......|||
  Rat   127 LCPEPLAWCSD-SDRDSSEATLSEALTDFSVKLYHAFSATKKAETNMAFSPFSIASLLTQVLLGA 190

  Fly    84 ENETATQLDQGLGLASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQF 148
            .:.|.:.|:..|    |.|:..| ..||.|.|:....:..::         |:....|..:...:
  Rat   191 GDSTKSNLEDIL----SYPKDFA-CVHQTLKAFSSKGVTSVS---------QIFHSPDLAIRDTY 241

  Fly   149 LSAAQSV----------DFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFK 203
            ::|:.|:          |...|::   .||.||.:.|||.|.:|:  |.|.|::||||:||::..
  Rat   242 VNASLSLYGSSPRVLGPDGDANLK---LINTWVAENTNHKINELL--DSLPSDTRLVLLNAVYLS 301

  Fly   204 GTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKE----RFRYADLPALDAMALELPYKDSDLSML 264
            ..|:..|.:........:.:.  .::|||:|.|:    .|....|.| ....|:|.:   :||.:
  Rat   302 AKWKKTFEQKKMMASFLYKNS--MIKVPMLSSKKYPLALFNDQTLKA-KVGQLQLSH---NLSFV 360

  Fly   265 IVLPNTKT-GLPALEEKLRLTTLSQITQSLYETK---VALKLPRFKAEFQVELSEVFQKLGMSRM 325
            |::|.:.| .|..:|:.|..|....|.:.|..:|   ..:.:||.|.:...::..:.:||.....
  Rat   361 IMVPQSPTHQLEDMEKALNPTVFKAILKKLELSKFQPTYVMMPRIKVKSSQDMLSIMEKLEFFDF 425

  Fly   326 FSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHP 390
            ..|....| :.:.|: |:||::.|:..:|:.|.|.|||||:.::|.|...|        |....|
  Rat   426 TYDLNLCG-LTEDPD-LQVSSMKHETVLELTETGVEAAAASTISVARNLLI--------FEVQQP 480

  Fly   391 FTYVLVHQK-DLPLFWGSV 408
            |.::|..|: ..|:|.|.|
  Rat   481 FLFLLWDQRHKFPVFMGRV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 106/382 (28%)
Serping1NP_954524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..132 2/4 (50%)
SERPIN 150..499 CDD:294093 106/383 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.