DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinb6e

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:373 Identity:118/373 - (31%)
Similarity:194/373 - (52%) Gaps:20/373 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFH 110
            |.|::.|. ::.|:...:|:.|||.|:.:..:|..|||...||:|:.:.|.|.:.:... ...||
  Rat     9 ATFALKVL-RVLGEDSSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNG-GGDFH 71

  Fly   111 Q----VLAAYQDS---QILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDF-SKNVQAAATI 167
            |    :|.....|   .:|:.:|.:||.|.:::...|.....|.:.:..:::|| ....|:...|
  Rat    72 QCFQSLLTEVNKSDRRHMLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPEQSRQHI 136

  Fly   168 NNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPM 232
            |.||.::|..:|::|:....:||.::|||:|:.:|||.|:..|.|..||...|.:.......|.|
  Rat   137 NTWVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKNEKKIVQM 201

  Fly   233 MSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQIT--QSLYE 295
            |..|..||...:..:......|||..:.||:.|:||:....|..:|.::....|.:.|  :::.|
  Rat   202 MFNKSNFRTYHVEDISTTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEKLIEWTRLENMQE 266

  Fly   296 TKVALKLPRFKAEFQVELSEVFQKLGMSRMFSD-QAEFGKMLQSPEPLKVSAIIHKAFIEVNEEG 359
            .:|.:.|||||.|...::..|..||||:..|.| :|:|..:...| .|.:|.::||:.:||||||
  Rat   267 EEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFSGISSKP-GLFLSKVVHKSVVEVNEEG 330

  Fly   360 TEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLP-LFWG 406
            |||||.|.:.     .:.||..|....|||||.:::...::.. ||.|
  Rat   331 TEAAAPTEIV-----TMGSPLSPQCLVADHPFLFLIQDDRNKAILFLG 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 118/373 (32%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.