DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinb8

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:362 Identity:125/362 - (34%)
Similarity:194/362 - (53%) Gaps:20/362 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQV 112
            |:|::...|..:....|:.|.|.|:.:..||..|||:..||||:.|.||| |.|.: :...|..:
  Rat    11 FAISLLKILGEEDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSQVLGL-SGDGD-VHQGFQTL 73

  Fly   113 LAAYQDS---QILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAA-ATINNWVEQ 173
            ||....|   .:|:.|.::|..:.......|.:...|.:.:..:.:.|.|:.:.. ..||:||.:
  Rat    74 LAEVNKSGTQYLLKSACRLFGEESCDFLSTFKESCQKFYQAGIEEMSFVKDTEGCRKRINDWVLE 138

  Fly   174 RTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKER 238
            :|...|.:::....:...::||||||::|||.|:.||.:..||...|..:.|....|.||....:
  Rat   139 KTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEEKKTVQMMFKHAK 203

  Fly   239 FRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALE-----EKLRLTTLSQITQSLYETKV 298
            |:.|.:..::|..|.|||.:.:|||:::||:..:.|..:|     ||||..|   ..::|.|:||
  Rat   204 FKMAHVDEVNAQVLALPYAEDELSMVVLLPDESSDLTVVEKALTYEKLRAWT---NPETLTESKV 265

  Fly   299 ALKLPRFKAEFQVELSEVFQKLGMSRMFSD-QAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEA 362
            .:..||.|.|...:|..|.|.|||:..|.: :|:|..| .|.:.:.||.:.||.|:|||||||||
  Rat   266 QVFFPRLKLEESYDLETVLQSLGMTDAFEETKADFSGM-TSKKNVPVSKVAHKCFVEVNEEGTEA 329

  Fly   363 AAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQK 399
            ||.|.: :|..|:...  || .|.||.||.:.:.|||
  Rat   330 AATTAV-IRNTRSCRI--EP-RFCADRPFLFFIWHQK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 125/362 (35%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 125/362 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm12319
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.