DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinf2

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:390 Identity:113/390 - (28%)
Similarity:188/390 - (48%) Gaps:54/390 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EFARRLA----LFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGL--GLA 98
            |..|||:    .|:.:::..::......|:|.||.|:....:...|||.|:|...|.:.|  .:.
  Rat    77 EETRRLSQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENLQRVLHMNMG 141

  Fly    99 SSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQF------LSAAQSVDF 157
            |..|..::| |.|.|    :...:|:|.:|::..|:.::.:|.:...|.|      |:..|..|.
  Rat   142 SCIPHLLSH-FCQNL----NPGTIRLAARIYLQKGFPIKDDFLEQSEKLFGAKPVKLTGRQEEDL 201

  Fly   158 SKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHL 222
                   ..||.||::.|...|:|.:  ..|...:.|:|:|||||.|.|:.:|...||:.|:|||
  Rat   202 -------MNINKWVKEATEGKIEDFL--SELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHL 257

  Fly   223 DGERTVQVPMMSLKE-RFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTL 286
            |.:.||.|.||..:. ..|:..|...:......|:: :::|.::::| |..|....|....||..
  Rat   258 DEQFTVPVAMMHAQSYPLRWFLLEQPEIQVAHFPFQ-NNMSFVVIMP-TYFGWNVSEVLANLTWD 320

  Fly   287 SQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSP-------EPLKV 344
            :....|:.|....::||:...|..::|.....|||:..:|          |||       :.|.|
  Rat   321 TLYQPSMREKPTKVRLPKLHLEQHLDLVATLSKLGLQDLF----------QSPDLRGISDQSLVV 375

  Fly   345 SAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQK-DLPLFWGSV 408
            |::.|::.:|::|.|.||||||..|:.|    ||..   .||.:.||.:.::.:. .:|||.|||
  Rat   376 SSVQHQSTMELSEAGVEAAAATSTAMTR----MSLS---SFFLNRPFIFFIMEETIGIPLFVGSV 433

  Fly   409  408
              Rat   434  433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 108/383 (28%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 108/383 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.