DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinf1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:382 Identity:99/382 - (25%)
Similarity:175/382 - (45%) Gaps:32/382 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PVHTADVTMADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETAT 89
            ||...|.....|...:.|..::.|..::|...||.....||:.||.|:.|..:...||||..|.:
  Rat    38 PVVEEDDPFFKAPVNKLAAAVSNFGYDLYRLRSGAVSTGNILLSPLSVATALSALSLGAEQRTES 102

  Fly    90 QLDQGLGLASSDPEQIAHSFHQVLAAY-QDSQILRIANKIFVMDGYQLRQEFDQLLSKQF----- 148
            .:.:.|.....:...|..::.::||:. ...:..:.|::|......:::..|...|.|.:     
  Rat   103 VIHRALYYDLINNPDIHSTYKELLASVTAPEKNFKSASRIVFERKLRVKSSFVAPLEKSYGTRPR 167

  Fly   149 -LSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRL--VLVNAIHFKGTWQHQF 210
             |:....:|..:       |||||:.:    :|..:........|.|  :|:...:|||.|..:|
  Rat   168 ILTGNPRIDLQE-------INNWVQAQ----MKGKIARSTREMPSALSILLLGVAYFKGQWATKF 221

  Fly   211 AKHLTRPDTFHLDGERTVQVPMMS-LKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKT-G 273
            ....|....||||.:|||:||||| .|...||.....|:....:||...| :|::..||.|.| .
  Rat   222 DSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGS-MSIIFFLPLTVTQN 285

  Fly   274 LPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQS 338
            |..:||.|....:..|.:.|...:..|.:|:.|..::.:::...|.:.:..:| :..:|.|:  :
  Rat   286 LTMIEESLTSEFVHDIDRELKTIQAVLTVPKLKLSYEGDVTNSLQDMKLQSLF-ESPDFSKI--T 347

  Fly   339 PEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVL 395
            .:|:|::.:.|:|..|.||||  |..::...::..|...    |:::..:.||.:||
  Rat   348 GKPVKLTQVEHRAAFEWNEEG--AGTSSNPDLQPVRLTF----PLDYHLNRPFIFVL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 94/362 (26%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 97/380 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.