DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpina3b

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_766612.1 Gene:Serpina3b / 271047 MGIID:2182835 Length:420 Species:Mus musculus


Alignment Length:387 Identity:110/387 - (28%)
Similarity:181/387 - (46%) Gaps:30/387 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LALFSINV------YGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGL--GLASSD 101
            |.|.|||.      |.:|:.:.|.:||.||||.|.|......|||:..|..::.:.|  .|..:.
Mouse    45 LTLASINTDFAFSFYKELALKNPHKNIAFSPFGIATALNSLTLGAKGNTLEEILEVLKFNLTETS 109

  Fly   102 PEQIAHSFHQVL--AAYQDSQI-LRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQA 163
            ...|...|..:|  .::...|: :|..|.:||....|:..||.:.....:.:...:.:|.:..:|
Mouse   110 EADIHQGFKHLLQRLSHPGDQVQIRTGNALFVEKHLQILAEFKEKARALYHTEVFTANFQQPHEA 174

  Fly   164 AATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTV 228
            ...||:::..:|...||:|| :| ::..:.:|:||.:.||..|...|....|....|.:|..|.|
Mouse   175 MKLINSYMSNQTQGKIKELV-SD-MDGNTSMVIVNDLFFKAEWMVPFNSDDTFMGKFIVDRSRHV 237

  Fly   229 QVPMMSLKE-RFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQS 292
            :||||..|. |..|.....|....:||.||.:..:|.|:....|  :..:|..|:..||.:..:|
Mouse   238 KVPMMKTKNLRTPYFRDEELKCTVVELNYKGNGKAMFILPDQGK--MQQVEASLQPGTLKKWRKS 300

  Fly   293 LYETKV-ALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVN 356
            |...|: .|.||:|.......|.::..:||:..:||.||:... :...:.:.||.:||...:::.
Mouse   301 LRPRKIKELHLPKFSLSQHYNLEDILPELGIRELFSTQADLSG-ITGVKNITVSEMIHSTELDMT 364

  Fly   357 EEGTEAAAATGMAVRRKRAIMSPE-EPIEFFADHPFTYVLVHQKDLPLFW----GSVVRLEE 413
            |:|||..|.|.:...    .||.: :|:....:..|.|:::.|.||   |    |.|:...|
Mouse   365 EKGTEGDAITIVGYN----FMSAKLKPVFVKFEDQFLYIVLDQGDL---WIHVMGKVINPSE 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 108/380 (28%)
Serpina3bNP_766612.1 SERPIN 51..414 CDD:294093 104/374 (28%)
RCL 367..392 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.