DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpine1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_036752.2 Gene:Serpine1 / 24617 RGDID:3249 Length:402 Species:Rattus norvegicus


Alignment Length:410 Identity:126/410 - (30%)
Similarity:191/410 - (46%) Gaps:37/410 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGLALF-------PFPPVHTADVTMADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQ 73
            |||.|.       |.|..||             |::...|.:.|:..:.......|:||||:.:.
  Rat    12 LGLVLVFGKGFASPLPESHT-------------AQQATNFGVKVFQHVVQASKDRNVVFSPYGVS 63

  Fly    74 TCAAMARLGAENETATQLDQGLGLASSD---PEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQ 135
            :..||.:|....:|..|:...:|...|:   ...:.....:::.::..::| ..|:.|||....:
  Rat    64 SVLAMLQLTTAGKTRQQIQDAMGFNISERGTAPALRKLSKELMGSWNKNEI-STADAIFVQRDLE 127

  Fly   136 LRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAI 200
            |.|.|.....|.|.:..:.||||:..:|...||:|||:.|..:|.||:....:|..:|||||||:
  Rat   128 LVQGFMPHFFKLFRTTVKQVDFSEMERARFIINDWVERHTKGMISDLLAKGAVNELTRLVLVNAL 192

  Fly   201 HFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAM---ALELPYKDSDLS 262
            :|.|.|:..|.:..|....||.....|:.||||:...:|.|.:....|..   .|||||....||
  Rat   193 YFNGQWKTPFLEASTHQRLFHKSDGSTISVPMMAQNNKFNYTEFTTPDGHEYDILELPYHGETLS 257

  Fly   263 MLIVLPNTK-TGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMF 326
            |.|..|..| ..|.|:...|....:.|...::......|.||:|..|.:|:|....:||||:.:|
  Rat   258 MFIAAPFEKDVPLSAITNILDAELIRQWKSNMTRLPRLLILPKFSLETEVDLRGPLEKLGMTDIF 322

  Fly   327 SD-QAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHP 390
            |. ||:| ..|...|.|.|:..:.|..|||||.||.|:::|.:.|..:.|      |.|...|..
  Rat   323 SSTQADF-TSLSDQEQLSVAQALQKVKIEVNESGTVASSSTAILVSARMA------PTEMVLDRS 380

  Fly   391 FTYVLVHQ-KDLPLFWGSVV 409
            |.:|:.|. .:..||.|.::
  Rat   381 FLFVVRHNPTETILFMGQLM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 117/371 (32%)
Serpine1NP_036752.2 serpin 29..402 CDD:422956 120/393 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.