DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinb10

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:279 Identity:84/279 - (30%)
Similarity:141/279 - (50%) Gaps:28/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 MARLGAENETATQLDQGLGLASSDP--------------------EQIAHSFHQVLAAY----QD 118
            |..||.:..||.|:.|.|..:|.:.                    |:|...| |.|||.    .:
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDF-QTLAAEILKPGN 64

  Fly   119 SQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDF-SKNVQAAATINNWVEQRTNHLIKDL 182
            |.:|:.||:|:....|....::.:.:...|.:..|||:| ..:.|....||:||..:|...|.:|
Mouse    65 SYVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPNL 129

  Fly   183 VPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPAL 247
            :|.|.:::::::|||||::|||||:|||:...|....|.::...:..|.|||:|:..:...:..|
Mouse   130 LPDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVFHIEEL 194

  Fly   248 DAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQS-LYET-KVALKLPRFKAEFQ 310
            ..:.|:|.|::.|||:|::||....||..||..:....|.:.|.: :.:| :|.|.||:||.|..
Mouse   195 QTIGLQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEES 259

  Fly   311 VELSEVFQKLGMSRMFSDQ 329
            .:|....:....|..:|.:
Mouse   260 YDLKSALRGQKFSGPYSKE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 84/279 (30%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 83/276 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3483
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.