DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinb6d

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001070258.1 Gene:Serpinb6d / 238568 MGIID:2667783 Length:375 Species:Mus musculus


Alignment Length:384 Identity:128/384 - (33%)
Similarity:191/384 - (49%) Gaps:39/384 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PFPPVHTADVTMADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENE 86
            |.|.::|           :||.:|.        |.......:||..||.||.:..||..|||:..
Mouse     3 PLPKLNT-----------KFAFKLL--------KALDDDTSKNIFLSPPSIASSLAMTLLGAKEN 48

  Fly    87 TATQLDQGLGL--ASSDP-EQIAHSFHQVLAAYQDSQ---ILRIANKIFVMDGYQLRQEFDQLLS 145
            ||.|:.|.|.|  .|||| |.|...||.:|.....:.   ||:..|::||...:.:::.|.....
Mouse    49 TARQIRQTLSLDKCSSDPCEDIHQDFHLLLNEVNKTDPGIILKTENRLFVEKTFHIKKSFKDASQ 113

  Fly   146 KQFLSAAQSVDFSKNV-QAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQ 209
            |.:.:..:.:||..:. |:...||.||.:.|:..||||:....:||.:||||||..:|||.|:..
Mouse   114 KFYKAEIEELDFKGDTEQSRQHINTWVTKNTDEKIKDLLSPGSVNSNTRLVLVNDFYFKGYWEKP 178

  Fly   210 FAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGL 274
            |.|..||...|.:.......|.||..|..|:...:..:....|.|||..:.|:|:|:||:....|
Mouse   179 FNKEDTREMPFRVSKNVVKPVQMMFQKSTFKITYIEEISTKILLLPYAGNKLNMIIMLPDEHVEL 243

  Fly   275 PALEEKLRLTTLSQIT--QSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSD-QAEFGKML 336
            ..||:|:......:.|  ..:.|.:|.:.|||||.|...:::.|..|:||:..|.: :|:|.. :
Mouse   244 RMLEKKMTYEKFVEWTSLDKMNEEEVEVFLPRFKLEEIYDMNNVLYKMGMTDAFEEGRADFSG-I 307

  Fly   337 QSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPI--EFFADHPFTY 393
            .|.:.|.:|.:|:||||||.|:||:.||||.:       :|....|.  .|.|||||.:
Mouse   308 SSKQGLFLSKVIYKAFIEVIEKGTKVAAATDI-------VMMGASPTTHTFCADHPFIF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 123/361 (34%)
Serpinb6dNP_001070258.1 SERPIN 4..375 CDD:294093 127/383 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.