DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpina3n

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:411 Identity:129/411 - (31%)
Similarity:200/411 - (48%) Gaps:48/411 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGL-------ALFPFPPVHTADVTMA-DAAHQE------FARRLALFSIN------VYGKLSGQK 60
            |||       |:..||     |.|:. |||.||      ....|.|.|||      :|.:|..:.
Mouse     7 LGLLMAGICPAVLCFP-----DGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKN 66

  Fly    61 PGENIVFSPFSIQTCAAMARLGAENETATQLDQGL--GLASSDPEQIAHSFHQVLAAY---QDSQ 120
            |.:||||||.||....|:..|||:..|..::.:||  .|..:....|...|..:|...   :|..
Mouse    67 PDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQV 131

  Fly   121 ILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPA 185
            .:...:.:|:....|:..||.:.....:.:.|.:.||.:..||...||::|.::|..:||:|| :
Mouse   132 QISTGSALFIEKRQQILTEFQEKARALYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELV-S 195

  Fly   186 DVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKE----RFRYADLPA 246
            | |:..:.:||||.|:||..|:..|....|....|:....|.|.|||||:::    .||..:   
Mouse   196 D-LDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEE--- 256

  Fly   247 LDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKV-ALKLPRFKAEFQ 310
            |....:||.| ..:.|.:.:||: :..:..:|..|:..||.:...||....: .|.||:|.....
Mouse   257 LFCTVVELKY-TGNASAMFILPD-QGKMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTD 319

  Fly   311 VELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRA 375
            ..|.:|..|||:..:||.||:. ..:...:.|:||.::|||.::|.|.|||||||||:    |..
Mouse   320 YSLEDVLSKLGIREVFSTQADL-SAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGV----KFV 379

  Fly   376 IMSPE-EPIEFFADHPFTYVL 395
            .||.: .|:..:.:.||..::
Mouse   380 PMSAKLYPLTVYFNRPFLIMI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 116/368 (32%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 116/376 (31%)
RCL 367..392 13/28 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.