DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinb9e

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_035586.1 Gene:Serpinb9e / 20710 MGIID:894672 Length:377 Species:Mus musculus


Alignment Length:360 Identity:112/360 - (31%)
Similarity:194/360 - (53%) Gaps:18/360 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHS---- 108
            |:|::...|....|.||:.:||.||.:..||..|||:.:||.|:.|.|.|   :|::..|.    
Mouse    11 FAIHLLKVLCQDNPSENVCYSPMSISSALAMVLLGAKGDTAVQICQALHL---NPDEDVHQGFQL 72

  Fly   109 -FHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAAT-INNWV 171
             .|.:.........|.:||::||.:..:|...|.:...|.:.|..:.:.|::..:.:.. ||.||
Mouse    73 LLHNLNKPNNQKYCLTMANRLFVENTCELLPTFKKSCLKFYHSEIEQLSFAEAAEESRQHINMWV 137

  Fly   172 EQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLK 236
            .::|...|.||:..|.::|::||:|.||::|:|||...|.|..|:...|.::.:.|..|.||..:
Mouse   138 SKQTKGKIPDLLSEDSVDSQTRLILANALYFQGTWCKFFEKDSTKEVPFKINKKETRPVQMMWQE 202

  Fly   237 ERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQIT--QSLYETKVA 299
            :.|.:|.:..:.|..|.:||:..||:.:::||:....:..:|..|....|:..|  :.:..|::.
Mouse   203 DTFFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDQGVDISKVENNLTFEKLTAWTKPEFMNRTELH 267

  Fly   300 LKLPRFKAEFQVELSEVFQKLGMSRMFS-DQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEA- 362
            :.||:||.:...:::.:.|.||:..:|: .:|:|..| .:.|.|.:|..:||..:||||||||| 
Mouse   268 VYLPKFKLQEDYDMNSLLQHLGILDVFNGSKADFSGM-STKENLCLSKFVHKCVVEVNEEGTEAV 331

  Fly   363 AAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVH 397
            ||:.|..:    ......:|..|.|||||.:.::|
Mouse   332 AASAGKII----LFCDGPDPEVFCADHPFLFFIMH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 112/360 (31%)
Serpinb9eNP_035586.1 SERPIN 4..377 CDD:294093 112/360 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.