DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinb9f

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_899020.1 Gene:Serpinb9f / 20709 MGIID:894671 Length:377 Species:Mus musculus


Alignment Length:359 Identity:117/359 - (32%)
Similarity:199/359 - (55%) Gaps:16/359 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQV 112
            |:|::...|....|.:|:.:||.||.:..||..|||:.:||.|:.|.|.|   :|::..|...|:
Mouse    11 FAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHL---NPDEDVHQGFQL 72

  Fly   113 LAAYQDSQ-----ILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAAT-INNWV 171
            |....:.|     .||:||::||.:..:|...|.:...|.:.|..:.:.|:|..:.:.. ||.||
Mouse    73 LLHNLNKQNNQKYCLRMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAKAAEESRQHINMWV 137

  Fly   172 EQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLK 236
            .::||..|.||:..|.:||::||:|.||::|.|||..:|.|:.|:...|.::.:.|..|.||..:
Mouse   138 SKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQMMWRE 202

  Fly   237 ERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQIT--QSLYETKVA 299
            :...:|.:..:.|..|.:||:..||:.:::||:....:..:|..|....|:..|  :.:..|:..
Mouse   203 DTLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFH 267

  Fly   300 LKLPRFKAEFQVELSEVFQKLGMSRMF-SDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAA 363
            :.||:|:.:...:::.:.|.||:..:| ..:|:...| .:.|.|.:|..:||..:||||||||||
Mouse   268 VYLPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGM-STKENLCLSEFVHKCVVEVNEEGTEAA 331

  Fly   364 AATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVH 397
            ||:  ||......:.| :|..|.|||||.:.::|
Mouse   332 AAS--AVEFIFLCLGP-DPETFCADHPFLFFIMH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 117/359 (33%)
Serpinb9fNP_899020.1 SERPIN 4..377 CDD:294093 117/359 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.