DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinb9c

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus


Alignment Length:368 Identity:124/368 - (33%)
Similarity:187/368 - (50%) Gaps:31/368 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQ- 111
            |::|:...|....|.:|:.:||.:|.:..||..||.:..|..|:.:.:||      ..|...|| 
Mouse    38 FAVNLLRMLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISEAIGL------NTAIDIHQS 96

  Fly   112 ------VLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAAT-INN 169
                  :|.........|:||::|..:..:....|.:...:.:....:.:.|:|..:.|.. ||.
Mouse    97 FLWILNILKKPTRKYTFRMANRLFAENTCEFLPTFKEPCLQFYHWEMEHLPFTKAPEEARNHINT 161

  Fly   170 WVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTR--PDTFHLDGERTVQVPM 232
            ||.:.|...|.:|:.:..::||:|||||||::|||.|.|||....||  |...:.|.||.||  |
Mouse   162 WVCKNTKGKIPELLSSGSVDSETRLVLVNALYFKGRWHHQFDIKSTRKMPFKINKDEERPVQ--M 224

  Fly   233 MSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLY--E 295
            |..::.|:.|.:..:....|.||||..:||::::||:....|..:|..|....||..|:..|  .
Mouse   225 MFQEDMFKLAYVNEVQVQVLVLPYKGKELSLVVLLPDDGVELSKVEGNLTFEKLSAWTKPDYLKT 289

  Fly   296 TKVALKLPRFKAEFQVELSEVFQKLGMSRMF-SDQAEFGKMLQSPE-PLKVSAIIHKAFIEVNEE 358
            |||.:.||:||.|...::..:||.||:..:| ..:|:..:|  ||| .|.||..|.|..:|||||
Mouse   290 TKVLVFLPKFKLEDYYDMESIFQDLGVGDIFQGGKADLSEM--SPERGLCVSKFIQKCVVEVNEE 352

  Fly   359 GTEAAAATGMAVRRKRAIMSPE--EPIEFFADHPFTYVLVHQK 399
            ||||.|||.     ...:.|.|  :...|.|||||.:.:.|.|
Mouse   353 GTEATAATA-----DDTVCSAETHDGQTFCADHPFLFFIRHNK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 124/368 (34%)
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 124/368 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.