DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINB1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens


Alignment Length:377 Identity:138/377 - (36%)
Similarity:206/377 - (54%) Gaps:27/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQV 112
            |:::::..||...|..||..|||||.:..||..||....||.||.:....  :..|:: ||..|.
Human    11 FALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHF--NTVEEV-HSRFQS 72

  Fly   113 LAAYQD----SQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFS-KNVQAAATINNWVE 172
            |.|..:    |.||::||:::....|....||.....|.:.:...||||. .:..|..|||.||:
Human    73 LNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVK 137

  Fly   173 QRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKE 237
            .:|...|.:|:.:.::::.::|||||||:|||.|:.:|.|..|....|.|:.:....|.||..|:
Human   138 GQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKK 202

  Fly   238 RFRYADLPALDAMALELPYKDSDLSMLIVLP----NTKTGLPALEEKLRLTTLSQIT--QSLYET 296
            :|.|..:..|....|||||:..:|||:|:||    :..|||..:||:|.|..|.:.|  ::|...
Human   203 KFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFI 267

  Fly   297 KVALKLPRFKAEFQVELSEVFQKLGMSRMF-SDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGT 360
            :|.:.|||||.|....|:....:||:..:| |.:|:...| .....:.:|.|:||:|:|||||||
Human   268 EVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGM-SGARDIFISKIVHKSFVEVNEEGT 331

  Fly   361 EAAAAT-GMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWGSVVRL 411
            |||||| |:|.   ..::.|||  .|.|||||.:.:.|...     ||::.|
Human   332 EAAAATAGIAT---FCMLMPEE--NFTADHPFLFFIRHNSS-----GSILFL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 136/372 (37%)
SERPINB1NP_109591.1 SERPIN 4..379 CDD:294093 138/377 (37%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.