DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpina12

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:414 Identity:102/414 - (24%)
Similarity:190/414 - (45%) Gaps:43/414 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLGLALF--------------PFPPVHTADVTMADAAHQEFARRLAL----FSINVYGKLSGQKP 61
            :|||.||              ..|..:.:.|.:.:...::.||.|..    |...:..:|:....
  Rat     4 VLGLGLFLAGLLTVKGLLQDRDAPDTYESPVRVQEWRGKKDARELTRHNMEFGFKLLQRLASNSR 68

  Fly    62 GENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAY----QDSQIL 122
            ..||..||.||.|..:|..|||:|.|..::.:|..........:...||.:|...    ||.: :
  Rat    69 QGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSDRDMHMGFHYLLQKLNRETQDVK-M 132

  Fly   123 RIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTN----HLIKDLV 183
            .|.|.:|:....:.:|.|.:|....:.:.....:|.........||.::.::|:    :::|::.
  Rat   133 SIGNALFMDQRLRPQQRFLKLAKNLYDADMILTNFQDLENTQKNINKYISRKTHNRIENMVKNID 197

  Fly   184 PADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALD 248
            |..|      ::|.|.|:|:|.||::|....|:.:.|.::..:||:||||..:..:..|....|.
  Rat   198 PGTV------MLLTNYIYFQGRWQYEFDPKQTKEEDFFIEEGKTVKVPMMFQRGMYDMAYDSQLS 256

  Fly   249 AMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVEL 313
            ...||:||: .:::...|||::.. |..||:.|:....::....|.:..|.:.:||........:
  Rat   257 CTILEMPYR-RNITATFVLPDSGK-LRLLEQGLQADIFAKWKSLLSKRVVDVWVPRLHISATYNM 319

  Fly   314 SEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMS 378
            .:|..:||:|::|.:..:..: :.|...|||...:|||.:.:||:|||.||.:|...      :.
  Rat   320 KKVLSRLGISKIFEEHGDLTR-ISSHRSLKVGEAVHKAELRMNEKGTEGAAGSGAQT------LP 377

  Fly   379 PEEPIEFFADHPFTYVLVHQKDLP 402
            .|.|.....:.|| .:::::..:|
  Rat   378 METPRRMKLNAPF-LMMIYENLMP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 93/370 (25%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 92/367 (25%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.