DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinf2

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:391 Identity:115/391 - (29%)
Similarity:194/391 - (49%) Gaps:31/391 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PVHTADVTMADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETAT 89
            |.|...|..|:.. :..|:.:..|:.:::..::......|:|.||.|:....:...|||:|:|..
Mouse    67 PGHCKSVPTAEET-RRLAQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLH 130

  Fly    90 QLDQGLGL--ASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAA 152
            .|.:.|.:  .|..|..::| |:|.|.    ...:|:|.:|::..|:.::.:|  |...:.|..|
Mouse   131 SLHRVLHMNTGSCLPHLLSH-FYQNLG----PGTIRLAARIYLQKGFPIKDDF--LEQSERLFGA 188

  Fly   153 QSVDFS-KNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTR 216
            :.|..: |..:..|.||.||::.|...|:|.:  ..|...:.|:|:|||||.|.|:.:|...||:
Mouse   189 KPVKLTGKQEEDLANINQWVKEATEGKIEDFL--SELPDSTVLLLLNAIHFHGFWRTKFDPSLTQ 251

  Fly   217 PDTFHLDGERTVQVPMM-SLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEK 280
            .|.||||...||.|.|| ::....|:..|...:......|:| :::|.::|:| |.......|..
Mouse   252 KDFFHLDERFTVSVDMMHAVSYPLRWFLLEQPEIQVAHFPFK-NNMSFVVVMP-TYFEWNVSEVL 314

  Fly   281 LRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQ--SPEPLK 343
            ..||..:....||.|....:.||:...:.|::|.....:||:..:|.     |..|:  |.:.|.
Mouse   315 ANLTWDTLYHPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQ-----GPDLRGISEQNLV 374

  Fly   344 VSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQK-DLPLFWGS 407
            ||::.|::.:|::|.|.||||||.:|:.|    ||..   .|..:.||.:.::... .:|||.||
Mouse   375 VSSVQHQSTMELSEAGVEAAAATSVAMNR----MSLS---SFTVNRPFLFFIMEDTIGVPLFVGS 432

  Fly   408 V 408
            |
Mouse   433 V 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 108/369 (29%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 109/373 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.